Property Summary

NCBI Gene PubMed Count 183
Grant Count 485
R01 Count 329
Funding $38,496,704.18
PubMed Score 849.87
PubTator Score 275.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.200 0.027
osteosarcoma 1.810 0.000
glioblastoma 1.600 0.003
pediatric high grade glioma 1.200 0.002
Polycystic Ovary Syndrome -1.158 0.033

Synonym

Gene

PXN

PDB

3RQE   3RQF   3RQG   2K2R   2VZD   2VZG   2VZI   4EDN   1KKY   1KL0   1OW6   1OW7   1OW8   2O9V   3GM1   3PY7   3U3F   4R32   4XGZ   4XH2  

Gene RIF (142)

PMID Text
27068854 blockade of GD3-mediated growth signaling pathways by siRNAs might be a novel and promising therapeutic strategy against malignant melanomas, provided signaling molecules such as p130Cas and paxillin are significantly expressed in individual cases.
26956728 Bit1 may be an important regulator in cell growth, apoptosis, migration and invasion of esophageal squamous cell carcinoma via targeting FAK-paxillin pathway.
26928467 Mode of Action of Functionally Important Regions in the Intrinsically Disordered Paxillin
26895766 Data suggest that, in colonic/prostatic neoplasm cells, increased expression of NDRG1 decreases activating phosphorylation of FAK and paxillin; silencing/inhibition of NDRG1 results in opposite effect and inhibits neoplasm cell migration/adhesion.
26530439 Results showed that the positive rate of PXN was significantly higher in the colorectal adenocarcinoma samples and correlated with TNM stage, distant metastasis and recurrence additionally to cetuximab resistance.
26464671 These findings suggest that PXN expression has potential use as a novel biomarker of laryngeal squamous cell carcinoma patients and may serve as an independent predictive factor for prognosis.
26349603 Fascin-1 and paxillin were expressed in 58% and 43% of infiltrating duct carcinoma cases. There was a significant correlation between fascin-1 and paxillin expression and tumor grade, clinical stage, lymph-node metastasis grade, and HER2 expression.
26159303 Paxillin was expressed at significantly higher levels in colorectal cancer tissues and might serve as a potential prognostic indicator in patients with colorectal cancer
25973017 these data suggested that miR-145 plays a pivotal role in colon cancer through inhibiting cell proliferation migration and invasion, and miR-145 may serve as a tumor suppressor by targeting paxillin gene.
25873394 findings reveal a novel mechanism by which PTEN inhibits the progression of colon cancer by inhibiting paxillin expression downstream of PI3K/AKT/NF-kappaB pathway
More...

AA Sequence

MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQ      1 - 70
PSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGS     71 - 140
NLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGL    141 - 210
EDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQG    211 - 280
LEQRADGERCWAAGWPRDGGRSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGV    281 - 350
ATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYC    351 - 420
NGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISA    421 - 490
LNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFV    491 - 560
CAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC                                           561 - 591
//

Text Mined References (201)

PMID Year Title
27068854 2016 A therapeutic trial of human melanomas with combined small interfering RNAs targeting adaptor molecules p130Cas and paxillin activated under expression of ganglioside GD3.
26956728 2016 Bit1 knockdown contributes to growth suppression as well as the decreases of migration and invasion abilities in esophageal squamous cell carcinoma via suppressing FAK-paxillin pathway.
26928467 2016 Deciphering Mode of Action of Functionally Important Regions in the Intrinsically Disordered Paxillin (Residues 1-313) Using Its Interaction with FAT (Focal Adhesion Targeting Domain of Focal Adhesion Kinase).
26895766 2016 Targeting the Metastasis Suppressor, N-Myc Downstream Regulated Gene-1, with Novel Di-2-Pyridylketone Thiosemicarbazones: Suppression of Tumor Cell Migration and Cell-Collagen Adhesion by Inhibiting Focal Adhesion Kinase/Paxillin Signaling.
26530439 2016 Paxillin is positively correlated with the clinicopathological factors of colorectal cancer, and knockdown of Paxillin improves sensitivity to cetuximab in colorectal cancer cells.
26464671 2015 Expression of paxillin in laryngeal squamous cell carcinoma and its prognostic value.
26349603 2015 Cytoskeletal Focal Adhesion Proteins Fascin-1 and Paxillin Are Predictors of Malignant Progression and Poor Prognosis in Human Breast Cancer.
26159303 2015 Expression of Paxillin is Correlated with Clinical Prognosis in Colorectal Cancer Patients.
25973017 2015 MicroRNA-145 suppresses cell migration and invasion by targeting paxillin in human colorectal cancer cells.
25873394 2015 Phosphatase and Tensin Homolog (PTEN) Represses Colon Cancer Progression through Inhibiting Paxillin Transcription via PI3K/AKT/NF-?B Pathway.
More...