Property Summary

NCBI Gene PubMed Count 200
PubMed Score 902.94
PubTator Score 275.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.200 2.7e-02
glioblastoma 1.600 2.8e-03
osteosarcoma 1.810 2.9e-05
pediatric high grade glioma 1.200 2.1e-03
Polycystic ovary syndrome -1.158 3.3e-02

Protein-protein Interaction (3)

Gene RIF (155)

AA Sequence

MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQ      1 - 70
PSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGS     71 - 140
NLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGL    141 - 210
EDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQG    211 - 280
LEQRADGERCWAAGWPRDGGRSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGV    281 - 350
ATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYC    351 - 420
NGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISA    421 - 490
LNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFV    491 - 560
CAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC                                           561 - 591
//

Text Mined References (218)

PMID Year Title