Property Summary

NCBI Gene PubMed Count 23
PubMed Score 15.56
PubTator Score 72.27

Knowledge Summary

Patent (12,403)



  Differential Expression (5)

Disease log2 FC p
breast carcinoma -1.300 4.5e-03
lung adenocarcinoma -1.200 8.5e-08
lung carcinoma -1.800 4.5e-13
mucosa-associated lymphoid tissue lympho... 2.065 1.9e-02
psoriasis 1.100 4.4e-26

Gene RIF (14)

AA Sequence

EPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE                                     351 - 387

Text Mined References (25)

PMID Year Title