Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
Funding $36,381.34
PubMed Score 15.24
PubTator Score 72.27

Knowledge Summary

Patent (12,403)

Synonym

Accession P49019 A8K4G5 B2R830 E9PI97 Q8NGE4
Symbols HCA3
HM74
PUMAG
Puma-g
GPR109B

Gene

PANTHER Protein Class (2)

 Grant Application (2)

  TechDev Info (1)

Gene RIF (14)

PMID Text
26656756 new insights into the G protein coupling profiles of the HCA receptors and the function of the receptor's C terminus
25839160 HCA1/3 are necessary for breast cancer cells to balance lipid/fatty acid metabolism.
22289163 Activated HCAR3 signals to MAP kinase cascades via the PLC-dependent PKC and MMP-mediated EGFR pathways
21655214 In contrast, in a squamous cell carcinoma derived cell line, both GPR109A and GPR109B show a more diffuse cellular localization and the receptors are nearly non-functional.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20380810 these results demonstrate that GPR109A and GPR109B dimerization is a constitutive process occurring early during biosynthesis.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19633298 Data show that the coordinated PPARgamma-mediated regulation of the GPR81, GPR109A and GPR109B presents a novel mechanism by which TZDs may reduce circulating free fatty acid levels and perhaps ameliorate insulin resistance in obese patients.
19561068 the ligand receptor pair 3-OH-octanoic acid/GPR109B mediates a negative feedback regulation of adipocyte lipolysis in human but not in mouse
19502010 An A allele in HM74 was significantly associated with schizophrenia and with schizophrenia plus bipolar disorder combined.
More...

AA Sequence

MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLA      1 - 70
VADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKIS     71 - 140
NWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSAR    141 - 210
IIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITL    211 - 280
SFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSG    281 - 350
EPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE                                     351 - 387
//

Text Mined References (25)

PMID Year Title
26656756 2016 The role of the C-terminus of the human hydroxycarboxylic acid receptors 2 and 3 in G protein activation using G?-engineered yeast cells.
25839160 2015 Hydroxycarboxylic acid receptors are essential for breast cancer cells to control their lipid/fatty acid metabolism.
22289163 2012 Activated human hydroxy-carboxylic acid receptor-3 signals to MAP kinase cascades via the PLC-dependent PKC and MMP-mediated EGFR pathways.
21655214 2011 Nicotinic acid receptor abnormalities in human skin cancer: implications for a role in epidermal differentiation.
21454438 2011 International Union of Basic and Clinical Pharmacology. LXXXII: Nomenclature and Classification of Hydroxy-carboxylic Acid Receptors (GPR81, GPR109A, and GPR109B).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20380810 2010 Evidence for constitutive dimerization of niacin receptor subtypes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19633298 2009 Peroxisome proliferator-activated receptor gamma regulates expression of the anti-lipolytic G-protein-coupled receptor 81 (GPR81/Gpr81).
19561068 2009 Deorphanization of GPR109B as a receptor for the beta-oxidation intermediate 3-OH-octanoic acid and its role in the regulation of lipolysis.
More...