Property Summary

NCBI Gene PubMed Count 26
PubMed Score 45.80
PubTator Score 76.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.25663686736892E-12
pancreatic cancer 2300 1.24091981558283E-7
colon cancer 1475 6.14827630139276E-7
medulloblastoma 1524 6.80957039993123E-6
tuberculosis 1563 1.13051278415723E-5
lung cancer 4473 1.24957268515665E-5
lung adenocarcinoma 2714 4.89902775358568E-5
ovarian cancer 8492 1.43560051871507E-4
primitive neuroectodermal tumor 3031 1.92747674884424E-4
Multiple Sclerosis 498 2.13133313132921E-4
ductal carcinoma in situ 1745 2.18486053068042E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.89736514765664E-4
invasive ductal carcinoma 2950 0.00130381793493703
cutaneous lupus erythematosus 1056 0.00132216847849934
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00176911459112229
primary pancreatic ductal adenocarcinoma 1271 0.00928560195441938
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00968434238337534
breast carcinoma 1614 0.0106770495111896
subependymal giant cell astrocytoma 2287 0.0117617475776197
Barrett's esophagus 185 0.0138017328441538
osteosarcoma 7933 0.0164053894624568
esophageal adenocarcinoma 737 0.0176010007179145
Hydrolethalus syndrome 128 0.0275380074136598
fibroadenoma 557 0.0288305686463733
Breast cancer 3099 0.0355248382199235
Waldenstrons macroglobulinemia 765 0.039692368195524
Gaucher disease type 1 171 0.0464185652796912

Expression

Synonym

Accession P49006 D3DPQ0 Q5TEE6 Q6NXS5
Symbols F52
MLP
MRP
MLP1
MACMARCKS

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
26555156 MARCKSL1 showed potent anti-angiogenic activity and reduced the levels of VEGF and HIF-1alpha expression. MARCKSL1 decreased VEGFinduced phosphorylation of the PI3K/Akt signaling pathway components.
24863880 MARCKSL1 suppresses LOXL2-induced oncogenesis.
22772381 Patients with high expression of PPH3 and high MARCKSL1 protein had a lower survival rate versus patients with low MARCKSL1 and high PPH3 expression.
22751924 Gene knockdown in prostate cancer cells or in neurons reveals a critical role for MARCKSL1 in migration that is dependent on the phosphorylation state.

AA Sequence

MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPP      1 - 70
SQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTA     71 - 140
QEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE                   141 - 195
//

Text Mined References (37)

PMID Year Title
26555156 2016 MARCKSL1 exhibits anti-angiogenic effects through suppression of VEGFR-2-dependent Akt/PDK-1/mTOR phosphorylation.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24863880 2014 Lysyl oxidase-like 2 (LOXL2) controls tumor-associated cell proliferation through the interaction with MARCKSL1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22772381 2012 The prognostic value of MARCKS-like 1 in lymph node-negative breast cancer.
22751924 2012 c-Jun N-terminal kinase phosphorylation of MARCKSL1 determines actin stability and migration in neurons and in cancer cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...