Property Summary

NCBI Gene PubMed Count 26
Grant Count 92
R01 Count 58
Funding $10,270,823.86
PubMed Score 45.80
PubTator Score 76.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P49006 D3DPQ0 Q5TEE6 Q6NXS5
Symbols F52
MLP
MRP
MLP1
MACMARCKS

Gene

Gene RIF (4)

PMID Text
26555156 MARCKSL1 showed potent anti-angiogenic activity and reduced the levels of VEGF and HIF-1alpha expression. MARCKSL1 decreased VEGFinduced phosphorylation of the PI3K/Akt signaling pathway components.
24863880 MARCKSL1 suppresses LOXL2-induced oncogenesis.
22772381 Patients with high expression of PPH3 and high MARCKSL1 protein had a lower survival rate versus patients with low MARCKSL1 and high PPH3 expression.
22751924 Gene knockdown in prostate cancer cells or in neurons reveals a critical role for MARCKSL1 in migration that is dependent on the phosphorylation state.

AA Sequence

MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPP      1 - 70
SQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTA     71 - 140
QEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE                   141 - 195
//

Text Mined References (37)

PMID Year Title
26555156 2016 MARCKSL1 exhibits anti-angiogenic effects through suppression of VEGFR-2-dependent Akt/PDK-1/mTOR phosphorylation.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24863880 2014 Lysyl oxidase-like 2 (LOXL2) controls tumor-associated cell proliferation through the interaction with MARCKSL1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22772381 2012 The prognostic value of MARCKS-like 1 in lymph node-negative breast cancer.
22751924 2012 c-Jun N-terminal kinase phosphorylation of MARCKSL1 determines actin stability and migration in neurons and in cancer cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...