Property Summary

NCBI Gene PubMed Count 26
PubMed Score 43.58
PubTator Score 76.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Gene RIF (4)

AA Sequence

MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPP      1 - 70
SQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTA     71 - 140
QEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE                   141 - 195
//

Text Mined References (37)

PMID Year Title