Property Summary

NCBI Gene PubMed Count 35
Grant Count 3
R01 Count 3
Funding $154,546.43
PubMed Score 8.32
PubTator Score 7.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.300 0.018
oligodendroglioma 1.200 0.013
lung cancer 1.900 0.000
non primary Sjogren syndrome sicca 1.100 0.024
ovarian cancer 1.800 0.000

 GO Component (2)

 MGI Term (1)

Gene RIF (11)

PMID Text
25924900 Inhibition of DNA polymerases a, delra and e by AFP promoter-driven artificial microRNAs may lead to effective growth arrest of AFP-positive HCC cells,as novel strategy for gene therapy
25662213 The results show that the FF483-484 amino acids in the human Poleta (designated F1 motif) are necessary for the interaction of this polymerase with POLD2, the B subunit of the replicative DNA polymerase delta, both in vitro and in vivo.
21372597 DNA polymerase delta catalytic subunit p125 induced by mutant type p53 is associated with hepatocellular carcinoma invasion.
21079801 Results suggest that POLD2 and KSP37 might be potential prognostic biomarkers.
20574454 Observational study of gene-disease association. (HuGE Navigator)
20226869 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18818516 the crystal structure of p50*p66(N) complex featuring oligonucleotide binding and phosphodiesterase domains in p50
18765914 As a first step towards understanding the functional importance of their regulatory subunit interactions, the three-dimensional structure of the p50-p66 heterodimer of human Pol delta has been solved using X-ray crystallography.
12522211 The association of PDIP38 with pol delta was shown to occur in calf thymus tissue and mammalian cell extracts by GST-PDIP38 pull-down and coimmunoprecipitation experiments.
More...

AA Sequence

MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQ      1 - 70
QHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQ     71 - 140
RIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGE    141 - 210
SLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLD    211 - 280
EILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVS    281 - 350
DIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPED    351 - 420
QTVLLVTVPDFSATQTACLVNLRSLACQPISFSGFGAEDDDLGGLGLGP                         421 - 469
//

Text Mined References (41)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25924900 2015 DNA Polymerases as targets for gene therapy of hepatocellular carcinoma.
25662213 2015 FF483-484 motif of human Pol? mediates its interaction with the POLD2 subunit of Pol? and contributes to DNA damage tolerance.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21372597 2010 Significance of DNA polymerase delta catalytic subunit p125 induced by mutant p53 in the invasive potential of human hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21079801 2010 POLD2 and KSP37 (FGFBP2) correlate strongly with histology, stage and outcome in ovarian carcinomas.
20574454 2010 Polymorphisms in the base excision repair pathway and graft-versus-host disease.
More...