Property Summary

NCBI Gene PubMed Count 36
PubMed Score 8.52
PubTator Score 7.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 9.5e-07
lung cancer 4740 1.2e-04
oligodendroglioma 2850 1.3e-02
ependymoma 4679 1.8e-02
non primary Sjogren syndrome sicca 891 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Xeroderma pigmentosum variant type 4 3.577 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.300 1.8e-02
lung cancer 1.900 1.2e-04
non primary Sjogren syndrome sicca 1.100 2.4e-02
oligodendroglioma 1.200 1.3e-02
ovarian cancer 1.800 9.5e-07

 MGI Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (12)

AA Sequence

MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQ      1 - 70
QHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQ     71 - 140
RIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGE    141 - 210
SLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLD    211 - 280
EILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVS    281 - 350
DIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPED    351 - 420
QTVLLVTVPDFSATQTACLVNLRSLACQPISFSGFGAEDDDLGGLGLGP                         421 - 469
//

Text Mined References (52)

PMID Year Title