Property Summary

NCBI Gene PubMed Count 138
Grant Count 159
R01 Count 77
Funding $18,032,559.54
PubMed Score 310.31
PubTator Score 230.79

Knowledge Summary

Patent (78,385)

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
psoriasis -1.700 0.001
osteosarcoma 1.561 0.027
cystic fibrosis 1.161 0.000
glioblastoma -1.600 0.000
medulloblastoma, large-cell -2.300 0.000
adrenocortical carcinoma 1.448 0.009
intraductal papillary-mucinous adenoma (... -1.400 0.026
intraductal papillary-mucinous carcinoma... -2.200 0.001
lung cancer -1.300 0.026
colon cancer -1.800 0.000
adult high grade glioma -1.100 0.006
lung carcinoma 1.200 0.000
breast carcinoma -1.200 0.000
Alzheimer's disease -1.800 0.023
Pick disease -2.200 0.000
progressive supranuclear palsy -1.800 0.016
Breast cancer -2.400 0.000
invasive ductal carcinoma -1.800 0.000
ovarian cancer -3.600 0.000
head and neck cancer -1.100 0.011

Synonym

Accession P48995 Q14CE4 TrpC1
Symbols TRP1
HTRP-1

Gene

PANTHER Protein Class (2)

Gene RIF (119)

PMID Text
26647723 OC. Our results provide the basis for further investigations of the drug-resistance-related functions of TRPC1 in ovarian cancer and other forms of cancer.
26453325 In c-kit+ cardiac progenitor cells, silencing TRPC1 significantly reduced the Ca2+ signaling through store-operated Ca2+ channels, decreased cell proliferation and migration, and reduced expression of cyclin D1, cyclin E, and/or p-Akt.
26336927 RhoA interacts with and activates TRPC1 and thus stimulates rapid epithelial restitution after injury by inducing Ca(2+) signaling.
26280213 TRPC1 mRNA and protein levels were increased in FCDIa, FCDIIa, and FCDIIb patients.
26232624 data demonstrate that trafficking via fast recycling endosomes determines TRPC1-STIM1 clustering within ER-PM junctions following ER-Ca2+ store depletion which is critical for the surface expression and function of the channel.
25971967 TRPC1 functions as a major regulator of S1P3 and VEGFR2 expression.
25960236 TRPC1 may take part both in regulation of store-operated Ca(2+) entry and proliferation of hepatocellular carcinoma cells.
25824146 HIF-1alpha knockdown attenuated hypoxia-induced BMP4 expression and knockdown of either HIF-1alpha or BMP4 abolished hypoxia-induced TRPC expression and basal [Ca(2+)]i.
25535724 The decrease in mitochondrial Ca(2+) loading following CPA-induced endoplasmic reticulum depletion in TRPC1-silenced Huh7 cells suggests a possible role of TRPC1 in hepatocellular carcinoma cell apoptosis.
25533457 Imin channels are regulated by STIM2, TRPC3-containing INS channels are induced by STIM1, and TRPC1-composed Imax channels are activated by both STIM1 and STIM2.
More...

AA Sequence

MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEEN      1 - 70
SSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAIDSEVVGAVDILLNHRPKRSSRP     71 - 140
TIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHS    141 - 210
RFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSR    211 - 280
ELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKK    281 - 350
IMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPAL    351 - 420
ERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWD    421 - 490
AFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYD    491 - 560
KGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYN    561 - 630
VVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSK    631 - 700
WICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSK    701 - 770
FRNEIRDLLGFRTSKYAMFYPRN                                                   771 - 793
//

Text Mined References (140)

PMID Year Title
26647723 2016 Downregulation of transient receptor potential cation channel, subfamily C, member 1 contributes to drug resistance and high histological grade in ovarian cancer.
26453325 2015 Roles of store-operated Ca2+ channels in regulating cell cycling and migration of human cardiac c-kit+ progenitor cells.
26336927 2015 RhoA enhances store-operated Ca2+ entry and intestinal epithelial restitution by interacting with TRPC1 after wounding.
26280213 2015 Expression Patterns of TRPC1 in Cortical Lesions from Patients with Focal Cortical Dysplasia.
26232624 2015 Fast endocytic recycling determines TRPC1-STIM1 clustering in ER-PM junctions and plasma membrane function of the channel.
25971967 2015 Transient Receptor Potential Canonical 1 (TRPC1) Channels as Regulators of Sphingolipid and VEGF Receptor Expression: IMPLICATIONS FOR THYROID CANCER CELL MIGRATION AND PROLIFERATION.
25960236 2015 Silencing of TRPC1 regulates store-operated calcium entry and proliferation in Huh7 hepatocellular carcinoma cells.
25824146 2015 Hypoxia inducible factor-1-dependent up-regulation of BMP4 mediates hypoxia-induced increase of TRPC expression in PASMCs.
25535724 Simultaneous measurement of cytosolic and mitochondrial calcium levels: observations in TRPC1-silenced hepatocellular carcinoma cells.
25533457 2015 STIM1 and STIM2 proteins differently regulate endogenous store-operated channels in HEK293 cells.
More...