Property Summary

NCBI Gene PubMed Count 147
PubMed Score 340.73
PubTator Score 230.79

Knowledge Summary

Patent (78,385)

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.448 8.8e-03
adult high grade glioma -1.100 6.0e-03
Alzheimer's disease -1.200 4.8e-02
Breast cancer -2.400 9.5e-18
breast carcinoma -1.100 7.5e-30
colon cancer -1.100 4.5e-03
cystic fibrosis 1.161 2.5e-04
glioblastoma -1.100 1.0e-04
head and neck cancer -1.100 1.1e-02
intraductal papillary-mucinous adenoma (... -1.300 1.1e-02
intraductal papillary-mucinous carcinoma... -2.200 5.6e-04
invasive ductal carcinoma -1.800 3.1e-04
lung cancer -1.200 9.4e-03
lung carcinoma 1.200 3.7e-12
malignant mesothelioma -1.900 4.7e-06
medulloblastoma, large-cell -1.700 1.9e-04
osteosarcoma 1.561 2.7e-02
ovarian cancer -3.000 3.1e-08
Pick disease -1.700 1.2e-05
progressive supranuclear palsy -1.400 2.3e-02
psoriasis -1.500 6.2e-08

Gene RIF (128)

AA Sequence

MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEEN      1 - 70
SSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAIDSEVVGAVDILLNHRPKRSSRP     71 - 140
TIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHS    141 - 210
RFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSR    211 - 280
ELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKK    281 - 350
IMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPAL    351 - 420
ERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWD    421 - 490
AFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYD    491 - 560
KGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYN    561 - 630
VVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSK    631 - 700
WICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSK    701 - 770
FRNEIRDLLGFRTSKYAMFYPRN                                                   771 - 793
//

Text Mined References (149)

PMID Year Title