Property Summary

NCBI Gene PubMed Count 59
Grant Count 27
R01 Count 5
Funding $2,390,377.39
PubMed Score 81.52
PubTator Score 67.04

Knowledge Summary

Patent (15,315)

Expression

Gene RIF (35)

PMID Text
26462154 Knock down of CD97 led to an altered mechanical phenotype, reduced adhesion to a stromal layer and lower wildtype FLT3 expression.
26107567 present study suggested that the expressions of CD97 antigen and decay accelerating factor(DAF) were both upregulated in human cervical squamous cell carcinoma
26034356 CD97 promotes gastric cancer cell proliferation and invasion in vitro through exosome-mediated MAPK signaling pathway, and exosomal miRNAs are probably involved in activation of the CD97-associated pathway.
25714433 we identify the specific isoforms of CD97, a novel pro-invasive glioma antigen, across histologic grades of glioma and within BTICs. We also demonstrate a trend towards increased CD97 expression among the classical and mesenchymal GBM subtypes.
25174588 CD97 enhanced TIMP-2 secretion, leading to reduced MT-MMP-1 and -2 activities, impairing cell migration/invasion in vitro and lung macrometastasis in vivo and upregulating integrins. Both the NTF and the CTF of CD97 were required.
24949957 We conclude that CD97 is located in the SR and at the peripheral sarcolemma of human and murine skeletal muscle, where its absence affects the structure of the SR without impairing skeletal muscle function
24274104 These results provide the first experimental evidence that cd97 is a direct target of miR-126.
23838008 Lysophosphatidylethanolamine utilizes LPA(1) and CD97 in a breast cancer cell line.
23771909 study reports gene expression in skeletal muscle tissue of women with metabolic syndrome is enriched in inflammatory response-related genes; IL6R, HDAC9 and CD97 expression correlated negatively with insulin sensitivity; suggests a role for these 3 inflammatory genes in development of skeletal muscle insulin resistance in women
23658650 CD97 expression promotes invasion and migration in glioblastoma multiforme, but has no effect on tumor proliferation.
More...

AA Sequence

MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTETCDDINECAT      1 - 70
PSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSY     71 - 140
TCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDV    141 - 210
DECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFD    211 - 280
KVQDLGRDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPF    281 - 350
TYISPSNTELTLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAVAGILSIQNMTTLLANASLNLHS    351 - 420
KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDPPAKDVMPGPR    421 - 490
QELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHYDVEDWKLTLITRVGLALSLF    491 - 560
CLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWM    561 - 630
SLEGLELYFLVVRVFQGQGLSTRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPV    631 - 700
TFIILCNAVIFVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYV    701 - 770
FTILNCLQGAFLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI         771 - 835
//

Text Mined References (67)

PMID Year Title
26462154 2015 Association of the EGF-TM7 receptor CD97 expression with FLT3-ITD in acute myeloid leukemia.
26107567 2015 Immunohistochemical Expression and Prognostic Significance of CD97 and its Ligand DAF in Human Cervical Squamous Cell Carcinoma.
26034356 2015 CD97 promotes gastric cancer cell proliferation and invasion through exosome-mediated MAPK signaling pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25714433 2015 Proportional upregulation of CD97 isoforms in glioblastoma and glioblastoma-derived brain tumor initiating cells.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
25174588 2014 CD97 inhibits cell migration in human fibrosarcoma cells by modulating TIMP-2/MT1- MMP/MMP-2 activity--role of GPS autoproteolysis and functional cooperation between the N- and C-terminal fragments.
24949957 2014 Skeletal muscle expression of the adhesion-GPCR CD97: CD97 deletion induces an abnormal structure of the sarcoplasmatic reticulum but does not impair skeletal muscle function.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24274104 2014 Prometastatic GPCR CD97 is a direct target of tumor suppressor microRNA-126.
More...