Property Summary

NCBI Gene PubMed Count 34
PubMed Score 21.58
PubTator Score 19.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Distal arthrogryposis type 2B 4 0.0 0.0
Muscular Diseases 27 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.3e-08
fibroadenoma 559 2.3e-03
pterygium 76 2.8e-03
diabetes mellitus 1728 1.5e-02
Atopic dermatitis 952 1.8e-02
non-inflammatory breast cancer 66 2.6e-02
interstitial cystitis 2312 4.9e-02
Disease Target Count Z-score Confidence
Distal arthrogryposis 42 6.854 3.4

Expression

  Differential Expression (7)

Disease log2 FC p
Atopic dermatitis -1.100 1.8e-02
diabetes mellitus -1.400 1.5e-02
fibroadenoma 2.700 2.3e-03
interstitial cystitis -1.300 4.9e-02
non-inflammatory breast cancer -1.200 2.6e-02
psoriasis -1.800 1.3e-08
pterygium -1.500 2.8e-03

 MGI Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (11)

AA Sequence

MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHA      1 - 70
KIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRAN     71 - 140
LKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES                                141 - 182
//

Text Mined References (35)

PMID Year Title