Property Summary

NCBI Gene PubMed Count 31
Grant Count 24
R01 Count 16
Funding $1,835,582.59
PubMed Score 106.20
PubTator Score 301.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Gene RIF (16)

PMID Text
25066423 Crystal tryptophan 2,3-dioxygenase structure revealed eight residues playing critical roles in L-tryptophan oxidation.
24974860 IL-1beta is suggested to stimulate tryptophan catabolism and production of IL-6 and IL-8 by increasing TDO expression in endometriosis.
23630570 TDO is highly expressed in the brains of Alzheimer disease patients.
23558111 Identification of 12 polymorphisms in the human TDO2 promoter region, 2 of them corresponding to previously unknown single-nucleotide polymorphisms and 3 of them located in putative glucocorticoid-responsive elements.
22082147 Data suggest that T342 in hTDO has critical role in controlling substrate binding, substrate stereoselectivity, H-bonding interaction between enzyme and intermediates, and regulating the dynamics of protein structure.
21892828 The data suggest that TDO uses a ring-opening mechanism during N-formylkynurenine formation, rather than Criegee or dioxetane mechanisms as previously proposed.
21361337 Studies indicate that the heme dioxygenases are differentiated by their ability to catalyze the oxidation of l-tryptophan to N-formylkynurenine.
20361220 subtle differences between the TDO and IDO reactions
19637229 TDO mediates antimicrobial and immunoregulatory effects. TDO-dependent inhibition of T-cell growth might be involved in the immunotolerance observed in vivo during allogeneic liver transplantation.
19502010 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEH      1 - 70
LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDF     71 - 140
NDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLE    141 - 210
RTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKG    211 - 280
ERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHY    281 - 350
LRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD                  351 - 406
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25066423 2014 Structural and functional analyses of human tryptophan 2,3-dioxygenase.
24974860 2014 IL-1? increases expression of tryptophan 2,3-dioxygenase and stimulates tryptophan catabolism in endometrioma stromal cells.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23630570 2013 Expression of tryptophan 2,3-dioxygenase and production of kynurenine pathway metabolites in triple transgenic mice and human Alzheimer's disease brain.
23558111 Characterization of functional polymorphisms and glucocorticoid-responsive elements in the promoter of TDO2, a candidate gene for ethanol-induced behavioural disorders.
22308364 2012 Reversal of tumoral immune resistance by inhibition of tryptophan 2,3-dioxygenase.
22082147 2011 Molecular basis for the substrate stereoselectivity in tryptophan dioxygenase.
21976023 2011 An endogenous tumour-promoting ligand of the human aryl hydrocarbon receptor.
21892828 2011 The mechanism of formation of N-formylkynurenine by heme dioxygenases.
More...