Property Summary

Ligand Count 17
NCBI Gene PubMed Count 36
PubMed Score 773.56
PubTator Score 301.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (24)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.269 1.0e-04
astrocytic glioma -1.100 1.9e-02
Breast cancer 2.000 7.0e-05
breast carcinoma 1.100 1.0e-17
cutaneous lupus erythematosus 4.000 1.1e-04
ductal carcinoma in situ 3.200 3.9e-03
gastric carcinoma 2.400 3.7e-02
head and neck cancer and chronic obstruc... 2.300 1.1e-03
interstitial cystitis 3.500 2.1e-04
invasive ductal carcinoma 3.100 1.8e-04
lung adenocarcinoma 1.700 1.2e-07
malignant mesothelioma 2.100 3.1e-07
medulloblastoma -1.300 3.4e-03
non-small cell lung cancer 1.499 2.2e-05
oligodendroglioma -1.300 2.5e-02
ovarian cancer 2.900 4.2e-03
pancreatic ductal adenocarcinoma liver m... -2.992 3.1e-02
periodontitis 1.400 4.7e-23
pituitary cancer -2.800 6.3e-06
primary Sjogren syndrome 1.100 2.5e-03
primitive neuroectodermal tumor -1.400 1.2e-02
psoriasis 2.600 7.8e-47
spina bifida -2.227 3.6e-02
ulcerative colitis 2.300 1.1e-02

Synonym

Accession P48775 A8K053 TDO
Symbols TO
TDO
TPH2
TRPO
HYPTRP

Gene

PANTHER Protein Class (2)

PDB

4PW8   5TI9   5TIA  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEH      1 - 70
LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDF     71 - 140
NDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLE    141 - 210
RTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKG    211 - 280
ERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHY    281 - 350
LRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD                  351 - 406
//

Text Mined References (37)

PMID Year Title