Property Summary

NCBI Gene PubMed Count 90
Grant Count 428
R01 Count 268
Funding $47,419,280.06
PubMed Score 406.26
PubTator Score 229.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ulcerative colitis -1.300 0.001

Synonym

Accession P48764 B7ZKR2 E9PF67 Q3MIW3
Symbols NHE3
DIAR8
NHE-3

Gene

Gene RIF (69)

PMID Text
26377793 Data demonstrate a role for Per1 in the transcriptional regulation of NHE3 and SGLT1 in the kidney.
26358773 Recessive mutations in NHE3, a downstream target of GC-C, caused congenital sodium diarrhea and implied primary basal NHE3 malfunction as a predisposition for inflammatory bowel disease in a subset of patients.
26258413 these findings indicate the importance of NHE3 in diabetic diarrhea and suggest LPA administration as a potential therapeutic strategy for management of diabetic diarrhea.
25855080 Study identifies RSK2 as a new kinase that regulates NHE3 activity by direct phosphorylation.
25715704 Results demonstrate decreased transport activity in three SNPs of NHE3 and provide mechanistic insight into how these SNPs impact NHE3 function.
25674247 NHE3 may play a role in the pathogenesis of human cholesterol gallstone disease
25552580 C. difficile inhibits NHE3 in vivo, which creates an altered environment favored by C. difficile.
25271043 Inflammation-induced loss of PDZK1 expression may contribute to the NHE3 dysfunction observed in the inflamed intestine.
24928903 Myosin VI mediates the movement of NHE3 to the microvillus in intestinal epithelial cells.
24874739 EIPA, a potent and specific inhibitor of Na+/H+ exchanger activity, significantly inhibits the Nef internalization into M2-macrophages, indicating that Nef is imported by Na+/H+ exchanger (solute carrier family 9, subfamily A)
More...

AA Sequence

MWGLGARGPDRGLLLALALGGLARAGGVEVEPGGAHGESGGFQVVTFEWAHVQDPYVIALWILVASLAKI      1 - 70
GFHLSHKVTSVVPESALLIVLGLVLGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFGNL     71 - 140
GTILLYAVVGTVWNAATTGLSLYGVFLSGLMGDLQIGLLDFLLFGSLMAAVDPVAVLAVFEEVHVNEVLF    141 - 210
IIVFGESLLNDAVTVVLYNVFESFVALGGDNVTGVDCVKGIVSFFVVSLGGTLVGVVFAFLLSLVTRFTK    211 - 280
HVRIIEPGFVFIISYLSYLTSEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASSAETII    281 - 350
FMFLGISAVNPFIWTWNTAFVLLTLVFISVYRAIGVVLQTWLLNRYRMVQLEPIDQVVLSYGGLRGAVAF    351 - 420
ALVVLLDGDKVKEKNLFVSTTIIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPRLNEKLHGRAFDHILSA    421 - 490
IEDISGQIGHNYLRDKWSHFDRKFLSRVLMRRSAQKSRDRILNVFHELNLKDAISYVAEGERRGSLAFIR    491 - 560
SPSTDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQSLEQRRRSIRDAEDMVTHHTLQQYLYKPRQE    561 - 630
YKHLYSRHELTPTEDEKQDREIFHRTMRKRLESFKSTKLGLNQNKKAAKLYKRERAQKRRNSSIPNGKLP    631 - 700
MESPAQNFTIKEKDLELSDTEEPPNYDEEMSGGIEFLASVTKDTASDSPAGIDNPVFSPDEALDRSLLAR    701 - 770
LPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPESTHM          771 - 834
//

Text Mined References (93)

PMID Year Title
26377793 2015 Transcriptional regulation of NHE3 and SGLT1 by the circadian clock protein Per1 in proximal tubule cells.
26358773 2015 Reduced sodium/proton exchanger NHE3 activity causes congenital sodium diarrhea.
26258413 2015 Restoration of Na+/H+ exchanger NHE3-containing macrocomplexes ameliorates diabetes-associated fluid loss.
26246427 2015 Proximal tubule NHE3 activity is inhibited by beta-arrestin-biased angiotensin II type 1 receptor signaling.
26041446 2015 Carbonic anhydrase II binds to and increases the activity of the epithelial sodium-proton exchanger, NHE3.
25855080 2015 Regulation of NHE3 by lysophosphatidic acid is mediated by phosphorylation of NHE3 by RSK2.
25715704 2015 Nonsynonymous single nucleotide polymorphisms of NHE3 differentially decrease NHE3 transporter activity.
25674247 2014 Expression and subcellular localization of NHE? in the human gallbladder epithelium.
25552580 2015 Human Clostridium difficile infection: inhibition of NHE3 and microbiota profile.
25271043 2015 Evidence for a causal link between adaptor protein PDZK1 downregulation and Na?/H? exchanger NHE3 dysfunction in human and murine colitis.
More...