Property Summary

NCBI Gene PubMed Count 80
Grant Count 94
R01 Count 37
Funding $12,596,745.6
PubMed Score 152.63
PubTator Score 386.49

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P48745 B2R5X7 Q6I9S3 Q96BY5 Q9UDE4 NovH
Symbols CCN3
NOVh
IBP-9
IGFBP9
IGFBP-9

Gene

NOV

PANTHER Protein Class (2)

Gene RIF (61)

PMID Text
26498181 Studies indicate that the CYR61 CTGF NOV matricellular proteins (CCN family of proteins) comprises the members CCN1, CCN2, CCN3, CCN4, CCN5 and CCN6 and have been identified in various types of cancer.
26367310 NOV expression was highly increased in biopsies of patients with tubulointerstitial nephritis.
26238193 Results revealed that NOV regulates the tumor growth of osteosarcoma cells through activation of the MAPK signaling pathway and promotes osteosarcoma cell migration in vitro.
25899830 our results argue that MZF-1 regulates the CTGF and NOV genes in the hematopoietic compartment, and may be involved in their respective functions in the stroma.
24721786 Overexpression of CCN3 induces M2 macrophage infiltration and contributes to angiogenesis in prostate cancer microenvironment.
24719190 NOV may promote carcinogenesis via promotion of EMT and association with increased mTOR activity
24431313 CCN3 may play an important role in cervical carcinogenesis and therefore may have potential as a biomarker for prognosis and as a therapeutic target in cervical cancer.
24406215 CCN3 can promote dentinogenesis by coordinating proliferation and odontoblastic differentiation of dental pulp stem cells via modulating Notch and BMP2 signaling pathways.
24308033 Demonstrated oncogenic role for NOTCH1 in Chronic Myelogenous Leukemia (CML) and BCR-ABL disruption of NOTCH1-CCN3 signalling may contribute to the pathogenesis of CML.
24258112 over-expression of NOV in pancreatic cancer cells promoted cell proliferation and migration, while knock down the expression of NOV impaired the tumorigenecity of pancreatic cancer cells in vitro and in vivo
More...

AA Sequence

MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQ      1 - 70
RGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGC     71 - 140
VPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQT    141 - 210
TEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKN    211 - 280
CTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELEL    281 - 350
KTTRGKM                                                                   351 - 357
//

Text Mined References (83)

PMID Year Title
26498181 2015 Emerging role of CCN family proteins in tumorigenesis and cancer metastasis (Review).
26367310 2015 Reduced NOV/CCN3 Expression Limits Inflammation and Interstitial Renal Fibrosis after Obstructive Nephropathy in Mice.
26238193 2015 NOV inhibits proliferation while promoting apoptosis and migration in osteosarcoma cell lines through p38/MAPK and JNK/MAPK pathways.
25899830 2015 Myeloid Zinc Finger 1 (MZF-1) Regulates Expression of the CCN2/CTGF and CCN3/NOV Genes in the Hematopoietic Compartment.
24722330 2014 Overexpression of CCN3 inhibits inflammation and progression of atherosclerosis in apolipoprotein E-deficient mice.
24721786 2014 Prostate cancer-derived CCN3 induces M2 macrophage infiltration and contributes to angiogenesis in prostate cancer microenvironment.
24719190 2014 NOV is upregulated and promotes migration and invasion in bladder cancer.
24431313 The clinical and prognostic significance of CCN3 expression in patients with cervical cancer.
24406215 2014 Promotion of dentin regeneration via CCN3 modulation on Notch and BMP signaling pathways.
24308033 2013 The matricellular protein CCN3 regulates NOTCH1 signalling in chronic myeloid leukaemia.
More...