Property Summary

NCBI Gene PubMed Count 84
PubMed Score 167.58
PubTator Score 386.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -2.595 6.6e-03
adult high grade glioma -1.100 4.9e-02
astrocytic glioma -1.900 4.1e-02
Astrocytoma, Pilocytic -1.300 8.1e-03
autosomal dominant Emery-Dreifuss muscul... 1.428 2.1e-02
Breast cancer -1.200 3.8e-02
cutaneous lupus erythematosus -1.600 1.1e-03
Endometriosis -1.592 5.7e-03
glioblastoma -1.100 1.4e-02
group 4 medulloblastoma -1.400 3.0e-02
interstitial cystitis 1.100 1.2e-05
intraductal papillary-mucinous adenoma (... -2.700 1.8e-04
intraductal papillary-mucinous carcinoma... -2.100 1.7e-02
invasive ductal carcinoma -1.600 2.7e-02
malignant mesothelioma 1.600 2.0e-07
medulloblastoma, large-cell -3.000 1.3e-03
nasopharyngeal carcinoma 1.700 1.3e-03
oligodendroglioma -2.300 3.6e-03
osteosarcoma 1.910 4.7e-02
ovarian cancer 1.300 3.3e-02
pituitary cancer -1.600 5.0e-05
posterior fossa group B ependymoma -1.100 1.2e-02
primitive neuroectodermal tumor -1.900 9.3e-03
psoriasis -1.100 8.9e-05

Protein-protein Interaction (2)

Gene RIF (65)

AA Sequence

MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQ      1 - 70
RGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGC     71 - 140
VPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQT    141 - 210
TEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKN    211 - 280
CTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELEL    281 - 350
KTTRGKM                                                                   351 - 357
//

Text Mined References (87)

PMID Year Title