Property Summary

NCBI Gene PubMed Count 80
PubMed Score 152.63
PubTator Score 386.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
Breast cancer 3099 5.56984219000186E-14
malignant mesothelioma 3163 9.13738710140264E-8
pituitary cancer 1972 1.96314941886267E-6
interstitial cystitis 2299 3.36074309524558E-5
psoriasis 6685 8.94605465354931E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.77095804372433E-4
medulloblastoma 1524 6.61403337390624E-4
cutaneous lupus erythematosus 1056 0.00112125810098098
medulloblastoma, large-cell 6234 0.00127976422174559
nasopharyngeal carcinoma 1056 0.00132586305364151
oligodendroglioma 2849 0.0035941486591071
ovarian cancer 8492 0.00437420017285664
adrenocortical carcinoma 1427 0.00663926190727208
pilocytic astrocytoma 3086 0.00887300553577741
primitive neuroectodermal tumor 3031 0.00933466194560538
posterior fossa group B ependymoma 1530 0.0118596608245397
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0165489724716015
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0208088837639509
Endometriosis 535 0.0211860661516895
invasive ductal carcinoma 2950 0.0267608328136324
glioblastoma 5572 0.0313556170916267
astrocytic glioma 2241 0.0412408043430439
osteosarcoma 7933 0.0470461756724841
adult high grade glioma 2148 0.0486247401468919
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.501 1.8

Expression

Synonym

Accession P48745 B2R5X7 Q6I9S3 Q96BY5 Q9UDE4 NovH
Symbols CCN3
NOVh
IBP-9
IGFBP9
IGFBP-9

Gene

NOV

PANTHER Protein Class (2)

  Ortholog (9)

 GWAS Trait (1)

Pathway (1)

Gene RIF (61)

PMID Text
26498181 Studies indicate that the CYR61 CTGF NOV matricellular proteins (CCN family of proteins) comprises the members CCN1, CCN2, CCN3, CCN4, CCN5 and CCN6 and have been identified in various types of cancer.
26367310 NOV expression was highly increased in biopsies of patients with tubulointerstitial nephritis.
26238193 Results revealed that NOV regulates the tumor growth of osteosarcoma cells through activation of the MAPK signaling pathway and promotes osteosarcoma cell migration in vitro.
25899830 our results argue that MZF-1 regulates the CTGF and NOV genes in the hematopoietic compartment, and may be involved in their respective functions in the stroma.
24721786 Overexpression of CCN3 induces M2 macrophage infiltration and contributes to angiogenesis in prostate cancer microenvironment.
24719190 NOV may promote carcinogenesis via promotion of EMT and association with increased mTOR activity
24431313 CCN3 may play an important role in cervical carcinogenesis and therefore may have potential as a biomarker for prognosis and as a therapeutic target in cervical cancer.
24406215 CCN3 can promote dentinogenesis by coordinating proliferation and odontoblastic differentiation of dental pulp stem cells via modulating Notch and BMP2 signaling pathways.
24308033 Demonstrated oncogenic role for NOTCH1 in Chronic Myelogenous Leukemia (CML) and BCR-ABL disruption of NOTCH1-CCN3 signalling may contribute to the pathogenesis of CML.
24258112 over-expression of NOV in pancreatic cancer cells promoted cell proliferation and migration, while knock down the expression of NOV impaired the tumorigenecity of pancreatic cancer cells in vitro and in vivo
More...

AA Sequence

MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQ      1 - 70
RGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGC     71 - 140
VPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQT    141 - 210
TEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKN    211 - 280
CTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELEL    281 - 350
KTTRGKM                                                                   351 - 357
//

Text Mined References (83)

PMID Year Title
26498181 2015 Emerging role of CCN family proteins in tumorigenesis and cancer metastasis (Review).
26367310 2015 Reduced NOV/CCN3 Expression Limits Inflammation and Interstitial Renal Fibrosis after Obstructive Nephropathy in Mice.
26238193 2015 NOV inhibits proliferation while promoting apoptosis and migration in osteosarcoma cell lines through p38/MAPK and JNK/MAPK pathways.
25899830 2015 Myeloid Zinc Finger 1 (MZF-1) Regulates Expression of the CCN2/CTGF and CCN3/NOV Genes in the Hematopoietic Compartment.
24722330 2014 Overexpression of CCN3 inhibits inflammation and progression of atherosclerosis in apolipoprotein E-deficient mice.
24721786 2014 Prostate cancer-derived CCN3 induces M2 macrophage infiltration and contributes to angiogenesis in prostate cancer microenvironment.
24719190 2014 NOV is upregulated and promotes migration and invasion in bladder cancer.
24431313 The clinical and prognostic significance of CCN3 expression in patients with cervical cancer.
24406215 2014 Promotion of dentin regeneration via CCN3 modulation on Notch and BMP signaling pathways.
24308033 2013 The matricellular protein CCN3 regulates NOTCH1 signalling in chronic myeloid leukaemia.
More...