Property Summary

NCBI Gene PubMed Count 13
PubMed Score 84.23
PubTator Score 7.14

Knowledge Summary

Patent

No data available

Synonym

Accession P48741 P19790
Symbols HSP70B

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
18584345 Nutritional stresses, specifically the absence of glucose and glutamine, induced the HSP70B promoter, resulting in production of the downstream gene product.
17915556 Celastrol induced expression of a wide set of Hsps, including Hsp70B', in differentiated human neurons grown in tissue culture.
17915554 Both Hsp70B' and Hsp72 are important for maintaining viability under conditions that increase the accumulation of damaged proteins in HT-29 cells.
17163517 A highly sensitive detection method of cytoxicity was developed using a modified HSPA7 promoter.
17044073 HSP70B expression is dependant on cell number and requires regulatory factors secreted by differentially secreted by cells at different stages of confluence.

AA Sequence

MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNPHNTVF      1 - 70
DAKRLIGRKFADTTVQSDMKHWPFQVVSEGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQP     71 - 140
VKHAVITVPTYFSNSQRQATKDAGAIAGLKVLPIINEATAAAIAYGLDRRGAGKRNVLIFDLGGGTFDVS    141 - 210
VLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTPSSST    211 - 280
QATLEIDSLFEGVDFYKSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDFVLGGGLHSHPQGAE    281 - 350
VAAGLLQRQGAEQEHQP                                                         351 - 367
//

Text Mined References (14)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18584345 2008 Induction of the human heat shock promoter HSP70B by nutritional stress: implications for cancer gene therapy.
17915556 2007 Induction of heat shock proteins in differentiated human and rodent neurons by celastrol.
17915554 2007 Hsp70B' regulation and function.
17163517 2007 Highly sensitive detection of cytotoxicity using a modified HSP70B' promoter.
17044073 2007 Cell number-dependent regulation of Hsp70B' expression: evidence of an extracellular regulator.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
More...