Property Summary

NCBI Gene PubMed Count 77
Grant Count 123
R01 Count 60
Funding $29,492,337.79
PubMed Score 303.83
PubTator Score 165.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession P48740 A8K542 A8K6M1 B4E2L7 O95570 Q68D21 Q8IUV8 Q96RS4 Q9UF09
Symbols 3MC1
MAP1
MASP
RaRF
CRARF
MASP3
MAp44
PRSS5
CRARF1

Gene

PANTHER Protein Class (3)

PDB

3DEM   3GOV   4AQB   4DJZ   4IGD   4IW4   4KKD  

Gene RIF (58)

PMID Text
26645987 described for the first time a detailed model of prothrombin activation by MASP-1
26371246 The levels of MASP-1 and MASP-1/C1-INH complexes are reduced in HAE patients compared with controls. Both MASP-1 and MASP-1/C1-INH complexes are related to the degree of complement C4 consumption
26260032 Fusion of MAP-1 with FH domains represents a novel therapeutic approach for selective targeting upstream and central complement activation at sites of inflammation
25862418 Polymorphisms in MASP1 and MASP2 genes are associated with the susceptibility or protection to infectious diseases. (Review)
25745807 MASP-1 cleaves prothrombin and identified its cleavage sites, suggesting that MASP-1 gives rise to an alternative active form of thrombin by cleaving at the cleavage site R393.
25533914 Because MASP-1 and MASP-2 have been shown to interact directly with blood coagulation, elevated levels of these proteins may play a role in the enhanced thrombotic environment and consequent vascular complications in diabetes.
24683193 We found that rMAP-1 can engage in heterocomplexes with rMASP-1 and rMASP-3 in a calcium-dependent manner
24489848 MASP-1 may activate neutrophils indirectly via endothelial cells.
24472859 Data show that among the components of the mannose-binding lectin (MBL) and associated serine proteases (MASPs) only MASP-1 is able to trigger response in endothelial cells (HUVECs) and the proteolytic activity of MASP-1 is essential.
24424083 Data indicate that MASP-1 and MASP-2 can readily form heterodimers after dissociation and re-association, however, in the presence of Ca(2+) exchange of subunits is slow between the homodimers.
More...

AA Sequence

MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESS      1 - 70
YLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDV     71 - 140
DECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSS    141 - 210
ECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFH    211 - 280
SDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECL    281 - 350
KDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVW    351 - 420
MNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAH    421 - 490
CLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLE    491 - 560
SPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMI    561 - 630
CAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN     631 - 699
//

Text Mined References (89)

PMID Year Title
26645987 2015 MASP-1 Induced Clotting--The First Model of Prothrombin Activation by MASP-1.
26419238 2015 Novel MASP1 mutations are associated with an expanded phenotype in 3MC1 syndrome.
26371246 2015 The Levels of the Lectin Pathway Serine Protease MASP-1 and Its Complex Formation with C1 Inhibitor Are Linked to the Severity of Hereditary Angioedema.
26260032 2015 Genetically engineered fusion of MAP-1 and factor H domains 1-5 generates a potent dual upstream inhibitor of both the lectin and alternative complement pathways.
25862418 2015 MBL-associated serine proteases (MASPs) and infectious diseases.
25745807 2015 MASP-1 of the complement system promotes clotting via prothrombin activation.
25533914 2015 Plasma levels of mannan-binding lectin-associated serine proteases MASP-1 and MASP-2 are elevated in type 1 diabetes and correlate with glycaemic control.
24683193 2014 Heterocomplex formation between MBL/ficolin/CL-11-associated serine protease-1 and -3 and MBL/ficolin/CL-11-associated protein-1.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24489848 2014 MASP-1 induces a unique cytokine pattern in endothelial cells: a novel link between complement system and neutrophil granulocytes.
More...