Property Summary

NCBI Gene PubMed Count 16
Grant Count 7
R01 Count 7
Funding $888,913
PubMed Score 25.14
PubTator Score 13.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

 GO Function (1)

Gene RIF (3)

PMID Text
20332109 Phosphatidylinositol and phosphatidylcholine exchange activity of PITPbeta is essential for COPI-mediated retrograde transport from the Golgi to the endoplasmic reticulum.
16780419 The presence of PITPbeta splice variants adds an extra level of proteome complexity
12023904 Role of PITPNB- not required for sphingomyelin trafficking

AA Sequence

MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPA      1 - 70
FVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVH     71 - 140
IDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVE    141 - 210
NFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV             211 - 271
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22822086 2012 Phosphatidylinositol transfer protein, cytoplasmic 1 (PITPNC1) binds and transfers phosphatidic acid.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
21269460 2011 Initial characterization of the human central proteome.
20332109 2010 Phosphatidylinositol- and phosphatidylcholine-transfer activity of PITPbeta is essential for COPI-mediated retrograde transport from the Golgi to the endoplasmic reticulum.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18755076 2008 Comparative proteomic analysis of peripheral blood mononuclear cells from atopic dermatitis patients and healthy donors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...