Property Summary

NCBI Gene PubMed Count 17
PubMed Score 25.16
PubTator Score 13.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Alzheimer's disease 1.100 1.6e-02
astrocytic glioma 2.100 1.2e-03
atypical teratoid / rhabdoid tumor -1.600 2.3e-06
ependymoma 2.200 2.3e-03
glioblastoma -1.300 1.4e-05
intraductal papillary-mucinous neoplasm ... 1.100 2.5e-02
juvenile dermatomyositis 1.083 4.7e-10
lung cancer 1.500 7.6e-03
non primary Sjogren syndrome sicca -1.300 1.2e-02
oligodendroglioma 2.400 2.0e-03
osteosarcoma 1.823 3.8e-05
ovarian cancer -1.200 1.3e-05
pancreatic ductal adenocarcinoma liver m... 1.051 2.1e-02
Pick disease 1.200 6.8e-05
pituitary cancer -1.100 3.2e-03
progressive supranuclear palsy 1.100 3.0e-02

Gene RIF (3)

AA Sequence

MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPA      1 - 70
FVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVH     71 - 140
IDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVE    141 - 210
NFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV             211 - 271
//

Text Mined References (21)

PMID Year Title