Property Summary

NCBI Gene PubMed Count 16
PubMed Score 25.14
PubTator Score 13.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 9.54683695945012E-12
juvenile dermatomyositis 1189 4.66247272536027E-10
Pick disease 1893 8.32931958180227E-7
atypical teratoid / rhabdoid tumor 4369 2.3233650210069E-6
glioblastoma 5572 1.35887269486708E-5
osteosarcoma 7933 3.80259825724528E-5
astrocytic glioma 2241 0.00123324977890009
oligodendroglioma 2849 0.00201817345202633
ependymoma 2514 0.00234508295902951
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0023790910916247
pituitary cancer 1972 0.00322177972967004
lung cancer 4473 0.00760757958303578
non primary Sjogren syndrome sicca 840 0.0123837954116425
Alzheimer's disease 644 0.0160793339525417
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0246289600923737
progressive supranuclear palsy 674 0.0295028321584208

Expression

  Differential Expression (16)

Synonym

Accession P48739 B3KYB8 B7Z7Q0 Q8N5W1 PI-TP-beta
Symbols VIB1B
PtdInsTP
PI-TP-beta

Gene

PANTHER Protein Class (1)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

 GO Function (1)

 MGI Term (1)

Gene RIF (3)

PMID Text
20332109 Phosphatidylinositol and phosphatidylcholine exchange activity of PITPbeta is essential for COPI-mediated retrograde transport from the Golgi to the endoplasmic reticulum.
16780419 The presence of PITPbeta splice variants adds an extra level of proteome complexity
12023904 Role of PITPNB- not required for sphingomyelin trafficking

AA Sequence

MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPA      1 - 70
FVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVH     71 - 140
IDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVE    141 - 210
NFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV             211 - 271
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22822086 2012 Phosphatidylinositol transfer protein, cytoplasmic 1 (PITPNC1) binds and transfers phosphatidic acid.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
21269460 2011 Initial characterization of the human central proteome.
20332109 2010 Phosphatidylinositol- and phosphatidylcholine-transfer activity of PITPbeta is essential for COPI-mediated retrograde transport from the Golgi to the endoplasmic reticulum.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18755076 2008 Comparative proteomic analysis of peripheral blood mononuclear cells from atopic dermatitis patients and healthy donors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...