Property Summary

NCBI Gene PubMed Count 362
Grant Count 37
R01 Count 18
Funding $7,216,826.66
PubMed Score 539.03
PubTator Score 182.59

Knowledge Summary

Patent (17,196)

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -2.193 0.003
periodontitis 1.100 0.000
non-small cell lung cancer -1.197 0.000
lung cancer -2.100 0.000
interstitial cystitis 1.700 0.001
pediatric high grade glioma 1.200 0.001
pilocytic astrocytoma 1.600 0.000
primary Sjogren syndrome 2.100 0.000
subependymal giant cell astrocytoma 2.595 0.004
invasive ductal carcinoma 1.129 0.000
lung carcinoma -2.100 0.000
ulcerative colitis 1.700 0.001
ovarian cancer -1.400 0.000

Synonym

Accession P48736 A4D0Q6 Q8IV23 Q9BZC8 PI3-kinase subunit gamma
Symbols PI3K
PIK3
PI3CG
PI3Kgamma
p110gamma
p120-PI3K

Gene

PANTHER Protein Class (2)

PDB

1HE8   1E8Y   1E8Z   2A4Z   2A5U   2CHW   2CHX   2CHZ   2V4L   3APC   3APD   3APF   3CSF   3CST   3DBS   3DPD   3ENE   3IBE   3L08   3L13   3L16   3L17   3L54   3LJ3   3MJW   3ML8   3ML9   3NZS   3NZU   3OAW   3P2B   3PRE   3PRZ   3PS6   3QAQ   3QAR   3QJZ   3QK0   3R7Q   3R7R   3S2A   3SD5   3T8M   3TJP   3TL5   3ZVV   3ZW3   4ANU   4ANV   4ANW   4ANX   4AOF   4DK5   4EZJ   4EZK   4EZL   4F1S   4FA6   4FAD   4FHJ   4FHK   4FJY   4FJZ   4FLH   4FUL   4G11   4GB9   4HLE   4HVB   4J6I   4KZ0   4KZC   4PS3   4PS7   4PS8   4URK   4WWN   4WWO   4WWP   4XX5   4XZ4   5EDS   5G2N  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (352)

PMID Text
26839042 Diminished expression of p110gamma in pulmonary vascular endothelial cells of patients with acute respiratory distress syndrome suggests that impaired p110gamma-FoxM1 vascular repair signaling is a critical factor in persistent leaky lung microvessels in ARDS.
26658747 Findings suggest the pathophysiological role of phosphoinositide 3-kinase gamma (PI3Kgamma) in atherogenesis.
26270987 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
26270987 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
26173259 data argue for differential regulatory functions of the non-catalytic subunits and a specific Gbetagamma-dependent regulation of p101 in PI3Kgamma activation.
26163264 findings suggest that miR-502 functions as a tumor suppressor in HCC via inhibition of PI3KCG, supporting its utility as a promising therapeutic gene target for this tumor type
26075907 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
25808869 Mfng is an oncogene acting through Notch-mediated induction of Pik3cg.
25753393 Our findings suggest that p84 binding to p110gamma may represent a novel negative feedback signal that terminates PI3Kgamma activity.
25751541 increased susceptibility of individuals with COPD to influenza likely results from impaired antiviral responses, which are mediated by increased PI3K-p110alpha activity.
More...

AA Sequence

MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQM      1 - 70
KAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQR     71 - 140
HPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEY    141 - 210
LWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEY    211 - 280
LVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVF    281 - 350
TVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI    351 - 420
KDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGK    421 - 490
GEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQLRKQLEAIIA    491 - 560
TDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQL    561 - 630
LDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLR    631 - 700
SEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQK    701 - 770
LENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ    771 - 840
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHW    841 - 910
LKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINK    911 - 980
ERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEY    981 - 1050
IRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA                     1051 - 1102
//

Text Mined References (365)

PMID Year Title
26839042 2016 Endothelial p110?PI3K Mediates Endothelial Regeneration and Vascular Repair After Inflammatory Vascular Injury.
26658747 2015 Variation in the Phosphoinositide 3-Kinase Gamma Gene Affects Plasma HDL-Cholesterol without Modification of Metabolic or Inflammatory Markers.
26173259 2015 Different inhibition of G??-stimulated class IB phosphoinositide 3-kinase (PI3K) variants by a monoclonal antibody. Specific function of p101 as a G??-dependent regulator of PI3K? enzymatic activity.
26163264 2015 miR-502 inhibits cell proliferation and tumor growth in hepatocellular carcinoma through suppressing phosphoinositide 3-kinase catalytic subunit gamma.
25808869 2015 Manic fringe promotes a claudin-low breast cancer phenotype through notch-mediated PIK3CG induction.
25753393 2015 p84 forms a negative regulatory complex with p110? to control PI3K? signalling during cell migration.
25751541 2015 Targeting PI3K-p110? Suppresses Influenza Virus Infection in Chronic Obstructive Pulmonary Disease.
25644171 2015 Non-canonical regulation of phosphatidylinositol 3-kinase gamma isoform activity in retinal rod photoreceptor cells.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
More...