Property Summary

Ligand Count 334
NCBI Gene PubMed Count 368
PubMed Score 579.45
PubTator Score 182.59

Knowledge Summary

Patent (17,196)

Expression

  Differential Expression (13)

Disease log2 FC p
lung cancer -1.500 3.5e-03
adult high grade glioma 1.200 7.1e-03
Astrocytoma, Pilocytic 1.600 1.4e-06
interstitial cystitis 1.400 1.0e-02
invasive ductal carcinoma 1.129 1.0e-04
lung carcinoma -2.100 7.8e-26
non-small cell lung cancer -1.197 5.0e-09
osteosarcoma -2.193 2.6e-03
ovarian cancer -1.400 2.2e-04
periodontitis 1.100 4.5e-20
primary Sjogren syndrome 2.100 1.5e-04
subependymal giant cell astrocytoma 2.595 3.7e-03
ulcerative colitis 1.700 6.7e-04

Synonym

Accession P48736 A4D0Q6 Q8IV23 Q9BZC8 PI3-kinase subunit gamma
Symbols PI3K
PIK3
PI3CG
PI3Kgamma
p110gamma
p120-PI3K

Gene

PANTHER Protein Class (2)

PDB

1HE8   1E8Y   1E8Z   2A4Z   2A5U   2CHW   2CHX   2CHZ   2V4L   3APC   3APD   3APF   3CSF   3CST   3DBS   3DPD   3ENE   3IBE   3L08   3L13   3L16   3L17   3L54   3LJ3   3MJW   3ML8   3ML9   3NZS   3NZU   3OAW   3P2B   3PRE   3PRZ   3PS6   3QAQ   3QAR   3QJZ   3QK0   3R7Q   3R7R   3S2A   3SD5   3T8M   3TJP   3TL5   3ZVV   3ZW3   4ANU   4ANV   4ANW   4ANX   4AOF   4DK5   4EZJ   4EZK   4EZL   4F1S   4FA6   4FAD   4FHJ   4FHK   4FJY   4FJZ   4FLH   4FUL   4G11   4GB9   4HLE   4HVB   4J6I   4KZ0   4KZC   4PS3   4PS7   4PS8   4URK   4WWN   4WWO   4WWP   4XX5   4XZ4   5EDS   5G2N   5G55   5JHA   5JHB   5KAE   5OQ4   5T23  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (354)

AA Sequence

MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQM      1 - 70
KAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQR     71 - 140
HPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEY    141 - 210
LWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEY    211 - 280
LVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVF    281 - 350
TVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI    351 - 420
KDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGK    421 - 490
GEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQLRKQLEAIIA    491 - 560
TDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQL    561 - 630
LDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLR    631 - 700
SEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQK    701 - 770
LENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ    771 - 840
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHW    841 - 910
LKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINK    911 - 980
ERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEY    981 - 1050
IRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA                     1051 - 1102
//

Text Mined References (371)

PMID Year Title