Property Summary

Ligand Count 1
NCBI Gene PubMed Count 274
PubMed Score 813.33
PubTator Score 288.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Acute myeloid leukemia, disease 30
Disease Target Count Z-score Confidence
2-hydroxyglutaric aciduria 4 0.0 5.0
Myelofibrosis 14 0.0 5.0

Expression

  Differential Expression (19)

Disease log2 FC p
Breast cancer 1.100 2.4e-05
ductal carcinoma in situ 1.400 5.8e-04
atypical teratoid / rhabdoid tumor -1.200 1.8e-03
breast carcinoma 1.100 2.3e-14
gastric carcinoma -1.300 1.2e-02
intraductal papillary-mucinous adenoma (... -1.400 1.2e-03
intraductal papillary-mucinous neoplasm ... -1.500 4.1e-03
invasive ductal carcinoma 1.700 5.2e-04
lung adenocarcinoma 1.199 6.7e-07
lung cancer 1.900 4.6e-05
medulloblastoma, large-cell -1.100 1.5e-03
Multiple myeloma 1.372 5.9e-03
non-small cell lung cancer 1.312 2.0e-19
osteosarcoma -1.510 8.1e-05
ovarian cancer 1.100 6.7e-05
pancreatic ductal adenocarcinoma liver m... -1.020 2.9e-03
posterior fossa group A ependymoma 1.100 1.1e-06
psoriasis -1.400 1.3e-04
tuberculosis 1.200 7.5e-07

 IMPC Phenotype (1)

Gene RIF (275)

AA Sequence

MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKL      1 - 70
ILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR     71 - 140
NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVY    141 - 210
NFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK    211 - 280
NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT    281 - 350
VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH    351 - 420
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ                                          421 - 452
//

Text Mined References (281)

PMID Year Title