Property Summary

NCBI Gene PubMed Count 237
Grant Count 64
R01 Count 45
Funding $5,516,490.59
PubMed Score 700.87
PubTator Score 288.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (51)

Disease Z-score Confidence
Cancer 2,346 5.155 2.6
D-2-hydroxyglutaric aciduria 9 4.904 2.5
Maffucci syndrome 7 4.729 2.4
Tropical spastic paraparesis 17 3.656 1.8
Papilloma 27 3.63 1.8
Interval angle-closure glaucoma 2 3.571 1.8
Ollier disease 15 3.495 1.7
ductal carcinoma in situ 1,745 3.113 1.6
Spinal cord disease 22 3.019 1.5
2-hydroxyglutaric aciduria 5 5.0
Anaplastic Oligoastrocytoma 1
Anaplastic Oligodendroglioma 2
Anaplastic astrocytoma 1
Angioimmunoblastic Lymphadenopathy 4
Breast cancer 3,094 1.0
Carcinoma 2,147 1.0
Cholangiocarcinoma 32
Chondroma 12
Combined D-2- and L-2-hydroxyglutaric ac... 4 
D-2-HYDROXYGLUTARIC ACIDURIA 2 1
DOID:2627 14 1.0
Degenerative polyarthritis 93
Enchondromatosis 4
Fibrillary astrocytoma 2
GLIOMA SUSCEPTIBILITY 1 3
Gemistocytic astrocytoma 1
Hemangioma 35
Immune system cancer 38 2.0
Mixed Oligodendroglioma-Astrocytoma 1
Multiple myeloma 1,327
Myelofibrosis 11 5.0
Osteoporosis 257
Peripheral T-cell lymphoma 24
Protoplasmic astrocytoma 1
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
gastric carcinoma 832
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
posterior fossa group A ependymoma 1,511
psoriasis 6,685
tuberculosis 1,557

Expression

Synonym

Accession P48735 B2R6L6 B4DFL2 Q96GT3 IDH
Symbols IDH
IDP
IDHM
IDPM
ICD-M
D2HGA2
mNADP-IDH

Gene

PDB

4JA8  

Gene RIF (238)

PMID Text
26945349 The IDH2 mutations are associated with improved survival in patients with Glioblastomas.
26834160 Our finding suggests that urinary 2-HG is increased among patients with isocitrate dehydrogenases (IDH1 and IDH2) -mutant gliomas, and may represent a future surrogate, noninvasive biomarker to aid in diagnosis, prognosis, and management
26761588 The Isocitrate dehydrogenase is mutated at a key active site arginine residue (Arg172 in IDH2) in many cancers, leading to the synthesis of the oncometabolite (R)-2-hydroxyglutarate (2HG).
26669865 IDH2 mutation produced more 2-HG than IDH1 mutation.
26646705 Down regulation of IDH2 may promote HCC cell invasion via NF-x03BA;B-dependent increases in MMP9 activity. IDH2 may be a potential therapeutic target for HCC
26562302 Data show that tet methylcytosine dioxygenase 2 TET2, isocitrate dehydrogenases 1/2 IDH1/IDH2, serine/arginine-rich splicing factor 2 SRSF2, splicing factor 3b subunit 1 SF3B1, and ras proteins (KRAS/NRAS) are not conserved in dog mast Cell tumors.
26558387 Most IDH mutant gliomas with TP53 mutations had at least one of the CNAs +7q, +8q, -9p, and -11p.
26545048 With the advent of large-scale genome sequencing technology, molecular genetic alterations in IDH2 promoter have now been identified in the majority of oligodendrogliomas
26486081 Data show that the monitoring of isocitrate dehydrogenase (NADP(+)) 1/2 IDH1/2 mutations showed that these mutations were reliable minimal residual disease (MRD) markers that allowed the prediction of relapse in the majority of patients.
26338964 Classification based on IDH1/2 mutation status and Ki-67 expression level could be more convenient for clinical application and guide personalized treatment in malignant gliomas.
More...

AA Sequence

MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKL      1 - 70
ILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR     71 - 140
NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVY    141 - 210
NFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK    211 - 280
NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT    281 - 350
VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH    351 - 420
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ                                          421 - 452
//

Text Mined References (244)

PMID Year Title
26945349 2016 Isocitrate Dehydrogenase (IDH)1/2 Mutations as Prognostic Markers in Patients With Glioblastomas.
26834160 2016 Elevation of Urinary 2-Hydroxyglutarate in IDH-Mutant Glioma.
26761588 2016 Photoactivation of Mutant Isocitrate Dehydrogenase 2 Reveals Rapid Cancer-Associated Metabolic and Epigenetic Changes.
26669865 2016 Noninvasive Quantification of 2-Hydroxyglutarate in Human Gliomas with IDH1 and IDH2 Mutations.
26646705 2015 Isocitrate Dehydrogenase 2 Suppresses the Invasion of Hepatocellular Carcinoma Cells via Matrix Metalloproteinase 9.
26562302 2015 Mutational Hotspot of TET2, IDH1, IDH2, SRSF2, SF3B1, KRAS, and NRAS from Human Systemic Mastocytosis Are Not Conserved in Canine Mast Cell Tumors.
26558387 2015 PCR-Based Simple Subgrouping Is Validated for Classification of Gliomas and Defines Negative Prognostic Copy Number Aberrations in IDH Mutant Gliomas.
26545048 2015 Molecular background of oligodendroglioma: 1p/19q, IDH, TERT, CIC and FUBP1.
26486081 2015 IDH1/2 but not DNMT3A mutations are suitable targets for minimal residual disease monitoring in acute myeloid leukemia patients: a study by the Acute Leukemia French Association.
26338964 2015 IDH1/2 mutation status combined with Ki-67 labeling index defines distinct prognostic groups in glioma.
More...