Property Summary

NCBI Gene PubMed Count 237
PubMed Score 700.87
PubTator Score 288.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
non-small cell lung cancer 2798 1.97997021390838E-19
breast carcinoma 1614 2.29222915816852E-14
lung adenocarcinoma 2714 6.68325912433721E-7
tuberculosis 1563 7.49290672489858E-7
posterior fossa group A ependymoma 1511 1.08997249538843E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 2.23098245775686E-5
lung cancer 4473 4.64669528276609E-5
osteosarcoma 7933 8.10291524620476E-5
psoriasis 6685 1.11882640017605E-4
ovarian cancer 8492 2.66465394963842E-4
invasive ductal carcinoma 2950 5.15674418669727E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00128552841493267
medulloblastoma, large-cell 6234 0.00146341137175126
atypical teratoid / rhabdoid tumor 4369 0.00181242213870228
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00414601865845408
Multiple myeloma 1328 0.00588120470458103
gastric carcinoma 832 0.0119803264766776
Disease Target Count Z-score Confidence
2-hydroxyglutaric aciduria 5 0.0 5.0
Myelofibrosis 13 0.0 5.0
Disease Target Count
Glioma 66

Expression

Synonym

Accession P48735 B2R6L6 B4DFL2 Q96GT3 IDH
Symbols IDH
IDP
IDHM
IDPM
ICD-M
D2HGA2
mNADP-IDH

Gene

PDB

4JA8  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG
S.cerevisiae OMA Inparanoid

Gene RIF (238)

PMID Text
26945349 The IDH2 mutations are associated with improved survival in patients with Glioblastomas.
26834160 Our finding suggests that urinary 2-HG is increased among patients with isocitrate dehydrogenases (IDH1 and IDH2) -mutant gliomas, and may represent a future surrogate, noninvasive biomarker to aid in diagnosis, prognosis, and management
26761588 The Isocitrate dehydrogenase is mutated at a key active site arginine residue (Arg172 in IDH2) in many cancers, leading to the synthesis of the oncometabolite (R)-2-hydroxyglutarate (2HG).
26669865 IDH2 mutation produced more 2-HG than IDH1 mutation.
26646705 Down regulation of IDH2 may promote HCC cell invasion via NF-x03BA;B-dependent increases in MMP9 activity. IDH2 may be a potential therapeutic target for HCC
26562302 Data show that tet methylcytosine dioxygenase 2 TET2, isocitrate dehydrogenases 1/2 IDH1/IDH2, serine/arginine-rich splicing factor 2 SRSF2, splicing factor 3b subunit 1 SF3B1, and ras proteins (KRAS/NRAS) are not conserved in dog mast Cell tumors.
26558387 Most IDH mutant gliomas with TP53 mutations had at least one of the CNAs +7q, +8q, -9p, and -11p.
26545048 With the advent of large-scale genome sequencing technology, molecular genetic alterations in IDH2 promoter have now been identified in the majority of oligodendrogliomas
26486081 Data show that the monitoring of isocitrate dehydrogenase (NADP(+)) 1/2 IDH1/2 mutations showed that these mutations were reliable minimal residual disease (MRD) markers that allowed the prediction of relapse in the majority of patients.
26338964 Classification based on IDH1/2 mutation status and Ki-67 expression level could be more convenient for clinical application and guide personalized treatment in malignant gliomas.
More...

AA Sequence

MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKL      1 - 70
ILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR     71 - 140
NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVY    141 - 210
NFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK    211 - 280
NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT    281 - 350
VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH    351 - 420
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ                                          421 - 452
//

Text Mined References (244)

PMID Year Title
26945349 2016 Isocitrate Dehydrogenase (IDH)1/2 Mutations as Prognostic Markers in Patients With Glioblastomas.
26834160 2016 Elevation of Urinary 2-Hydroxyglutarate in IDH-Mutant Glioma.
26761588 2016 Photoactivation of Mutant Isocitrate Dehydrogenase 2 Reveals Rapid Cancer-Associated Metabolic and Epigenetic Changes.
26669865 2016 Noninvasive Quantification of 2-Hydroxyglutarate in Human Gliomas with IDH1 and IDH2 Mutations.
26646705 2015 Isocitrate Dehydrogenase 2 Suppresses the Invasion of Hepatocellular Carcinoma Cells via Matrix Metalloproteinase 9.
26562302 2015 Mutational Hotspot of TET2, IDH1, IDH2, SRSF2, SF3B1, KRAS, and NRAS from Human Systemic Mastocytosis Are Not Conserved in Canine Mast Cell Tumors.
26558387 2015 PCR-Based Simple Subgrouping Is Validated for Classification of Gliomas and Defines Negative Prognostic Copy Number Aberrations in IDH Mutant Gliomas.
26545048 2015 Molecular background of oligodendroglioma: 1p/19q, IDH, TERT, CIC and FUBP1.
26486081 2015 IDH1/2 but not DNMT3A mutations are suitable targets for minimal residual disease monitoring in acute myeloid leukemia patients: a study by the Acute Leukemia French Association.
26338964 2015 IDH1/2 mutation status combined with Ki-67 labeling index defines distinct prognostic groups in glioma.
More...