Property Summary

NCBI Gene PubMed Count 80
Grant Count 368
R01 Count 233
Funding $120,982,299.25
PubMed Score 88.30
PubTator Score 41.41

Knowledge Summary

Patent (2,250)

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.146 0.006
malignant mesothelioma -1.600 0.000
ependymoma 1.600 0.004
oligodendroglioma 1.600 0.001
cutaneous lupus erythematosus 1.200 0.005
psoriasis 1.100 0.000
osteosarcoma -4.466 0.000
glioblastoma 1.700 0.000
astrocytoma 1.500 0.003
atypical teratoid / rhabdoid tumor 1.500 0.000
tuberculosis -1.100 0.000
lung cancer 1.200 0.001
breast carcinoma 1.300 0.006
pediatric high grade glioma 1.500 0.000
invasive ductal carcinoma 1.500 0.003
ovarian cancer -1.900 0.000

Synonym

Accession P48730 A2I2P2 Q96KZ6 Q9BTN5 CKI-delta
Symbols ASPS
HCKID
FASPS2
CKIdelta

Gene

PDB

3UYS   3UYT   3UZP   4HGT   4HNF   4KB8   4KBA   4KBC   4KBK   4TN6   4TW9   4TWC   5IH4   5IH5   5IH6  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
463077 confirmatory 12 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of casein kinase 1 delta (CK1d): radioactivity-based in vitro biochemical kinase assay to identify CK1d inhibitors

Gene RIF (33)

PMID Text
26769969 Expression of truncated hyperactive form of CKIdelta causes mislocalization and aggregation of TDP-43 in cultured cells.
26676609 CK1delta inhibition represents a promising strategy for targeted treatment in human breast cancer with Wnt/beta-catenin involvement.
25744540 Inhibition of CK1delta increases lipid droplet formation and proliferation of both cancer and normal cells specifically under hypoxia and in an HIF-1alpha- and lipin-1-dependent manner.
25724478 site-specific phosphorylation of adiponectin, especially at sites targeted by CK1delta in vitro, provides an additional regulatory mechanism for modulating adiponectin complex formation and function.
25665722 The dynamical and conformational properties for each of three isoforms of CK1 are explored through molecular dynamics (MD) simulations.
25404202 Results indicate that changes in the expression levels of casein kinase 1 isoforms CK1delta and DK1epsilon in colorectal tumors correlate with patients' survival.
24817118 role for CK1delta in controlling the cell cycle
24424021 CK1delta and CK1epsilon play a decisive role in triggering late steps of pre-40S maturation that are required for acquisition of functionality of 40S ribosomal subunits in protein translation.
23636092 decreases in CKIdelta activity can contribute to the pathogenesis of migraine.
23527964 molecular docking studies to examine the effect of the S97 mutation on its ATP-binding affinity; results explained the underlying molecular mechanism behind the observed cancer associated phenotype caused by S97C mutation in CK1delta protein
More...

AA Sequence

MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIRW      1 - 70
CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK     71 - 140
KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS    141 - 210
LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ    211 - 280
GFSYDYVFDWNMLKFGASRAADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTS    281 - 350
HTANTSPRPVSGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR         351 - 415
//

Text Mined References (103)

PMID Year Title
26769969 2016 Phosphorylation of TAR DNA-binding Protein of 43 kDa (TDP-43) by Truncated Casein Kinase 1? Triggers Mislocalization and Accumulation of TDP-43.
26676609 2015 Therapeutic targeting of casein kinase 1? in breast cancer.
25744540 2015 CK1? restrains lipin-1 induction, lipid droplet formation and cell proliferation under hypoxia by reducing HIF-1?/ARNT complex formation.
25724478 2015 Gene expression levels of Casein kinase 1 (CK1) isoforms are correlated to adiponectin levels in adipose tissue of morbid obese patients and site-specific phosphorylation mediated by CK1 influences multimerization of adiponectin.
25665722 2015 A comparative study of structural and conformational properties of casein kinase-1 isoforms: insights from molecular dynamics and principal component analysis.
25500533 2014 Phosphorylation of LRRK2 by casein kinase 1? regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25404202 2015 Effects of altered expression and activity levels of CK1? and ? on tumor growth and survival of colorectal cancer patients.
24817118 2014 Casein kinase 1?-dependent Wee1 protein degradation.
More...