Property Summary

Ligand Count 4
NCBI Gene PubMed Count 94
PubMed Score 67.58
PubTator Score 73.15

Knowledge Summary

Patent (14,835)

TINX Plot

  Disease (6)

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.086 4.3e-06
glioblastoma 1.100 1.4e-02
intraductal papillary-mucinous carcinoma... 1.100 4.4e-04
non primary Sjogren syndrome sicca 1.200 1.9e-02
osteosarcoma 1.868 5.5e-07
ovarian cancer 1.800 1.7e-06
psoriasis 1.600 1.0e-09

 GWAS Trait (1)

Gene RIF (45)

AA Sequence

MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGG      1 - 70
VGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPD     71 - 140
NFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYV    141 - 210
LMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQL    211 - 280
FRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF                 281 - 337
//

Text Mined References (107)

PMID Year Title