Property Summary

NCBI Gene PubMed Count 83
Grant Count 11
R01 Count 10
Funding $756,872.92
PubMed Score 66.05
PubTator Score 73.15

Knowledge Summary

Patent (14,835)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.600 0.000
osteosarcoma 1.868 0.000
glioblastoma 1.100 0.014
acute quadriplegic myopathy 1.086 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.000
non primary Sjogren syndrome sicca 1.200 0.019
ovarian cancer 1.800 0.000

 GWAS Trait (1)

Gene RIF (36)

PMID Text
27031502 The study describes the identification of a novel, tumor-specific missense mutation in the active site of casein kinase 1 alpha(CSNK1A1) using activity-based proteomics.
25798617 Casein kinase 1alpha is a key negative regulator of oncogenic RAS-induced autophagy. Depletion or pharmacologic inhibition of CK1alpha enhanced autophagic flux in oncogenic RAS-driven human fibroblasts and multiple cancer cell lines.
25792355 characterization of frequency and potential clinical impact of CSNK1A1 mutations in myelodysplastic syndrome(MDS) and acute myeloid leukemia following MDS in a large cohort of patients
25665722 The dynamical and conformational properties for each of three isoforms of CK1 are explored through molecular dynamics (MD) simulations.
25500533 Phosphorylation of LRRK2 by casein kinase 1alpha regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25124033 Degradation of Tiam1 by casein kinase 1 and the SCFbetaTrCP ubiquitin ligase controls the duration of mTOR-S6K signaling.
25100726 Casein kinase 1 alpha specifically phosphorylates Jade-1 at an unprimed SLS phosphorylation site.
24962017 CSNK1alpha1 has a role in mediating malignant plasma cell survival
23580615 Data indicate that protein S phosphorylation by casein kinase 1 (CK1) and casein kinase 2 (CK2) increased activated proten C cofactor activity.
23148689 The substrate interacting residues in ck1alpha have been identified using the structural model of kinase - substrate peptide. The PKR interacting NS5A 1b residues have also been predicted.
More...

AA Sequence

MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGG      1 - 70
VGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPD     71 - 140
NFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYV    141 - 210
LMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQL    211 - 280
FRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF                 281 - 337
//

Text Mined References (96)

PMID Year Title
27031502 2016 Identification of a Tumor Specific, Active-Site Mutation in Casein Kinase 1? by Chemical Proteomics.
25798617 2015 Casein kinase 1?-dependent feedback loop controls autophagy in RAS-driven cancers.
25792355 2015 Frequency and prognostic impact of casein kinase 1A1 mutations in MDS patients with deletion of chromosome 5q.
25665722 2015 A comparative study of structural and conformational properties of casein kinase-1 isoforms: insights from molecular dynamics and principal component analysis.
25500533 2014 Phosphorylation of LRRK2 by casein kinase 1? regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25124033 2014 Degradation of Tiam1 by casein kinase 1 and the SCF?TrCP ubiquitin ligase controls the duration of mTOR-S6K signaling.
25100726 2014 Casein kinase 1 ? phosphorylates the Wnt regulator Jade-1 and modulates its activity.
24962017 2015 CSNK1?1 mediates malignant plasma cell survival.
23902688 2013 A novel mechanism of keratin cytoskeleton organization through casein kinase I? and FAM83H in colorectal cancer.
23580615 2013 Phosphorylation of protein S by platelet kinases enhances its activated protein C cofactor activity.
More...