Property Summary

NCBI Gene PubMed Count 29
PubMed Score 157.88
PubTator Score 53.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.731 2.9e-06
atypical teratoid/rhabdoid tumor -1.100 4.5e-05
Breast cancer -2.400 3.8e-02
interstitial cystitis -1.200 5.5e-05
non-small cell lung cancer -1.045 1.3e-13
osteosarcoma -1.400 1.7e-03
pancreatic cancer -1.200 6.3e-03
primary pancreatic ductal adenocarcinoma -1.275 5.9e-03
primary Sjogren syndrome -1.200 1.4e-02
ulcerative colitis -1.200 1.0e-06

Gene RIF (16)

AA Sequence

MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHL      1 - 70
HTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHL     71 - 140
YVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVM    141 - 210
EVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEH    211 - 280
TTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSG    281 - 350
CPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK                     351 - 403
//

Text Mined References (32)

PMID Year Title