Property Summary

NCBI Gene PubMed Count 197
Grant Count 393
R01 Count 168
Funding $38,687,204.78
PubMed Score 2122.70
PubTator Score 416.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P48681 O00552 Q3LIF5 Q5SYZ6
Symbols Nbla00170

Gene

NES

Gene RIF (154)

PMID Text
26600525 higher rates of nestin expression were observed in most embryonal Rhabdomyosarcoma specimens and low-grade tumors, in early stages of the disease, and among younger patients.
26421614 The stem cell marker nestin and the epithelial-mesenchymal transition marker periostin allow prognostic stratification among histologic variants of malignant pleural mesothelioma. Their expression level is influenced by neo-adjuvant chemotherapy.
26414809 Nestin expression was consistently found in endothelial cells of the schneiderian membrane.
26335012 Administration of nestin siRNA significantly decreased primary and metastatic tumor formation by human pancreatic cancer cells.
26261513 Our findings indicated that Nestin plays an essential role in colorectal cancer progression
26242334 Increased miR-21 and nestin mRNA levels were found in anaplastic meningiomas, in which recurrence is
25967234 High level of CD133 expression trends to correlate with a worse OS and PFS in glioma patients, especially WHO IV gliomas
25940879 Nestin has been shown to be expressed in transformed cells of various human malignancies, and a correlation between its expression and the clinical course of some diseases has been proved. [review]
25854362 High nestin expression is associated with gastric adenocarcinoma.
25843934 Results indicate that nestin plays an important role in the embryonic development of at least two mouse organs (heart and brain) through the regulation of cell proliferation
More...

AA Sequence

MEGCMGEESFQMWELNRRLEAYLARVKALEEQNELLSAELGGLRAQSADTSWRAHADDELAALRALVDQR      1 - 70
WREKHAAEVARDNLAEELEGVAGRCQQLRLARERTTEEVARNRRAVEAEKCARAWLSSQVAELERELEAL     71 - 140
RVAHEEERVGLNAQAACAPRCPAPPRGPPAPAPEVEELARRLGEAWRGAVRGYQERVAHMETSLGQARER    141 - 210
LGRAVQGAREGRLELQQLQAERGGLLERRAALEQRLEGRWQERLRATEKFQLAVEALEQEKQGLQSQIAQ    211 - 280
VLEGRQQLAHLKMSLSLEVATYRTLLEAENSRLQTPGGGSKTSLSFQDPKLELQFPRTPEGRRLGSLLPV    281 - 350
LSPTSLPSPLPATLETPVPAFLKNQEFLQARTPTLASTPIPPTPQAPSPAVDAEIRAQDAPLSLLQTQGG    351 - 420
RKQAPEPLRAEARVAIPASVLPGPEEPGGQRQEASTGQSPEDHASLAPPLSPDHSSLEAKDGESGGSRVF    421 - 490
SICRGEGEGQIWGLVEKETAIEGKVVSSLQQEIWEEEDLNRKEIQDSQVPLEKETLKSLGEEIQESLKTL    491 - 560
ENQSHETLERENQECPRSLEEDLETLKSLEKENKELLKDVEVVRPLEKEAVGQLKPTGKEDTQTLQSLQK    561 - 630
ENQELMKSLEGNLETFLFPGTENQELVSSLQENLESLTALEKENQEPLRSPEVGDEEALRPLTKENQEPL    631 - 700
RSLEDENKEAFRSLEKENQEPLKTLEEEDQSIVRPLETENHKSLRSLEEQDQETLRTLEKETQQRRRSLG    701 - 770
EQDQMTLRPPEKVDLEPLKSLDQEIARPLENENQEFLKSLKEESVEAVKSLETEILESLKSAGQENLETL    771 - 840
KSPETQAPLWTPEEINQGAMNPLEKEIQEPLESVEVNQETFRLLEEENQESLRSLGAWNLENLRSPEEVD    841 - 910
KESQRNLEEEENLGKGEYQESLRSLEEEGQELPQSADVQRWEDTVEKDQELAQESPPGMAGVENEDEAEL    911 - 980
NLREQDGFTGKEEVVEQGELNATEEVWIPGEGHPESPEPKEQRGLVEGASVKGGAEGLQDPEGQSQQVGA    981 - 1050
PGLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVM   1051 - 1120
EPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELPGKSRDPWEPPREGREESEAEAPRGAEEAFPAE   1121 - 1190
TLGHTGSDAPSPWPLGSEEAEEDVPPVLVSPSPTYTPILEDAPGPQPQAEGSQEASWGVQGRAEALGKVE   1191 - 1260
SEQEELGSGEIPEGPQEEGEESREESEEDELGETLPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKE   1261 - 1330
GWDPAVLASEGLEAPPSEKEEGEEGEEECGRDSDLSEEFEDLGTEAPFLPGVPGEVAEPLGQVPQLLLDP   1331 - 1400
AAWDRDGESDGFADEEESGEEGEEDQEEGREPGAGRWGPGSSVGSLQALSSSQRGEFLESDSVSVSVPWD   1401 - 1470
DSLRGAVAGAPKTALETESQDSAEPSGSEEESDPVSLEREDKVPGPLEIPSGMEDAGPGADIIGVNGQGP   1471 - 1540
NLEGKSQHVNGGVMNGLEQSEEVGQGMPLVSEGDRGSPFQEEEGSALKTSWAGAPVHLGQGQFLKFTQRE   1541 - 1610
GDRESWSSGED                                                              1611 - 1621
//

Text Mined References (209)

PMID Year Title
26600525 2015 Immunohistochemical expression of nestin in rhabdomyosarcoma: implications for clinicopathology and patient outcome.
26421614 2015 Expression of the Stem Cell Factor Nestin in Malignant Pleural Mesothelioma Is Associated with Poor Prognosis.
26414809 2015 Regenerative potential of human schneiderian membrane: progenitor cells and epithelial-mesenchymal transition.
26335012 2016 Systemic Administration of Small Interfering RNA Targeting Human Nestin Inhibits Pancreatic Cancer Cell Proliferation and Metastasis.
26261513 2015 Knockdown of Nestin inhibits proliferation and migration of colorectal cancer cells.
26242334 2015 Expression of Stem Cell Marker Nestin and MicroRNA-21 in Meningiomas.
25967234 2015 Do relevant markers of cancer stem cells CD133 and Nestin indicate a poor prognosis in glioma patients? A systematic review and meta-analysis.
25940879 2015 Nestin as a marker of cancer stem cells.
25854362 2015 Correlation of overexpression of nestin with expression of epithelial-mesenchymal transition-related proteins in gastric adenocarcinoma.
25843934 2015 Nestin overexpression promotes the embryonic development of heart and brain through the regulation of cell proliferation.
More...