Property Summary

NCBI Gene PubMed Count 216
PubMed Score 2273.69
PubTator Score 416.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Epilepsy, Tonic-Clonic 10 0.0 0.0
Nephrosis 21 0.0 0.0
Disease Target Count
Tonic-clonic epilepsy 47
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.6
Liver cancer 604 0.0 0.6

Expression

  Differential Expression (28)

Disease log2 FC p
lung cancer 1.300 7.4e-04
adult high grade glioma 2.500 9.5e-06
Amyotrophic lateral sclerosis 1.448 3.7e-05
astrocytic glioma 1.800 5.3e-03
Astrocytoma, Pilocytic 2.000 1.2e-07
autosomal dominant Emery-Dreifuss muscul... 1.267 1.0e-02
Becker muscular dystrophy 1.573 2.1e-03
Breast cancer -2.000 2.8e-02
breast carcinoma -1.200 6.1e-04
cystic fibrosis -1.898 2.5e-05
diabetes mellitus -1.200 1.8e-03
Duchenne muscular dystrophy 2.158 4.5e-09
ependymoma 1.900 2.9e-02
glioblastoma 2.600 4.4e-11
intraductal papillary-mucinous adenoma (... -1.900 1.3e-05
intraductal papillary-mucinous carcinoma... -2.100 4.6e-06
intraductal papillary-mucinous neoplasm ... -1.900 3.4e-04
juvenile dermatomyositis 1.602 2.4e-08
limb girdle muscular dystrophy 2A 1.677 1.8e-06
lung adenocarcinoma -1.600 1.3e-11
malignant mesothelioma 7.200 3.5e-09
non-small cell lung cancer -1.214 1.2e-07
oligodendroglioma 2.300 7.4e-04
osteosarcoma 1.060 6.8e-03
ovarian cancer 1.500 4.7e-10
primitive neuroectodermal tumor 2.800 1.0e-04
psoriasis 1.500 2.7e-03
subependymal giant cell astrocytoma 2.147 5.4e-03

Gene RIF (173)

AA Sequence

MEGCMGEESFQMWELNRRLEAYLARVKALEEQNELLSAELGGLRAQSADTSWRAHADDELAALRALVDQR      1 - 70
WREKHAAEVARDNLAEELEGVAGRCQQLRLARERTTEEVARNRRAVEAEKCARAWLSSQVAELERELEAL     71 - 140
RVAHEEERVGLNAQAACAPRCPAPPRGPPAPAPEVEELARRLGEAWRGAVRGYQERVAHMETSLGQARER    141 - 210
LGRAVQGAREGRLELQQLQAERGGLLERRAALEQRLEGRWQERLRATEKFQLAVEALEQEKQGLQSQIAQ    211 - 280
VLEGRQQLAHLKMSLSLEVATYRTLLEAENSRLQTPGGGSKTSLSFQDPKLELQFPRTPEGRRLGSLLPV    281 - 350
LSPTSLPSPLPATLETPVPAFLKNQEFLQARTPTLASTPIPPTPQAPSPAVDAEIRAQDAPLSLLQTQGG    351 - 420
RKQAPEPLRAEARVAIPASVLPGPEEPGGQRQEASTGQSPEDHASLAPPLSPDHSSLEAKDGESGGSRVF    421 - 490
SICRGEGEGQIWGLVEKETAIEGKVVSSLQQEIWEEEDLNRKEIQDSQVPLEKETLKSLGEEIQESLKTL    491 - 560
ENQSHETLERENQECPRSLEEDLETLKSLEKENKELLKDVEVVRPLEKEAVGQLKPTGKEDTQTLQSLQK    561 - 630
ENQELMKSLEGNLETFLFPGTENQELVSSLQENLESLTALEKENQEPLRSPEVGDEEALRPLTKENQEPL    631 - 700
RSLEDENKEAFRSLEKENQEPLKTLEEEDQSIVRPLETENHKSLRSLEEQDQETLRTLEKETQQRRRSLG    701 - 770
EQDQMTLRPPEKVDLEPLKSLDQEIARPLENENQEFLKSLKEESVEAVKSLETEILESLKSAGQENLETL    771 - 840
KSPETQAPLWTPEEINQGAMNPLEKEIQEPLESVEVNQETFRLLEEENQESLRSLGAWNLENLRSPEEVD    841 - 910
KESQRNLEEEENLGKGEYQESLRSLEEEGQELPQSADVQRWEDTVEKDQELAQESPPGMAGVENEDEAEL    911 - 980
NLREQDGFTGKEEVVEQGELNATEEVWIPGEGHPESPEPKEQRGLVEGASVKGGAEGLQDPEGQSQQVGA    981 - 1050
PGLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVM   1051 - 1120
EPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELPGKSRDPWEPPREGREESEAEAPRGAEEAFPAE   1121 - 1190
TLGHTGSDAPSPWPLGSEEAEEDVPPVLVSPSPTYTPILEDAPGPQPQAEGSQEASWGVQGRAEALGKVE   1191 - 1260
SEQEELGSGEIPEGPQEEGEESREESEEDELGETLPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKE   1261 - 1330
GWDPAVLASEGLEAPPSEKEEGEEGEEECGRDSDLSEEFEDLGTEAPFLPGVPGEVAEPLGQVPQLLLDP   1331 - 1400
AAWDRDGESDGFADEEESGEEGEEDQEEGREPGAGRWGPGSSVGSLQALSSSQRGEFLESDSVSVSVPWD   1401 - 1470
DSLRGAVAGAPKTALETESQDSAEPSGSEEESDPVSLEREDKVPGPLEIPSGMEDAGPGADIIGVNGQGP   1471 - 1540
NLEGKSQHVNGGVMNGLEQSEEVGQGMPLVSEGDRGSPFQEEEGSALKTSWAGAPVHLGQGQFLKFTQRE   1541 - 1610
GDRESWSSGED                                                              1611 - 1621
//

Text Mined References (229)

PMID Year Title