Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.09
PubTator Score 9.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 6.900 0.000

Synonym

Accession P48668 A1L4L5 P48666 Q2TAZ9 Q7RTN9
Symbols K6E
KRT6E
PPKNEFD

Gene

Gene RIF (3)

PMID Text
23662636 mutation c.1414G>A resulting in an p.Glu472Lys substitution associated with focal plantar keratoderma
20081885 KRT6C mutations may have a role in focal palmoplantar keratoderma [commentary]
19609311 Keratin K6c mutations cause focal palmoplantar keratoderma

AA Sequence

MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRI      1 - 70
SIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTV     71 - 140
NQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNL    141 - 210
EPLFEQYINNLRRQLDSIVGERGRLDSELRNMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMN    211 - 280
KVELQAKADTLTDEINFLRALYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRA    281 - 350
EAESWYQTKYEELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCASLQAAIADAEQRGEMAL    351 - 420
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNVSVVQ    421 - 490
STISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRK    491 - 560
SYKH                                                                      561 - 564
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23662636 2013 Collapse of the keratin filament network through the expression of mutant keratin 6c observed in a case of focal plantar keratoderma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21801157 2011 Diffuse and focal palmoplantar keratoderma can be caused by a keratin 6c mutation.
20081885 2010 Mutations in a keratin 6 isomer (K6c) cause a type of focal palmoplantar keratoderma.
19609311 2010 Keratin K6c mutations cause focal palmoplantar keratoderma.
16831889 2006 New consensus nomenclature for mammalian keratins.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...