Property Summary

NCBI Gene PubMed Count 16
Grant Count 37
R01 Count 21
Funding $3,076,519.83
PubMed Score 70.50
PubTator Score 42.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.200 0.008
ependymoma -3.700 0.000
cutaneous lupus erythematosus -1.100 0.002
glioblastoma -2.400 0.000
group 3 medulloblastoma -3.900 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -2.600 0.016
Atopic dermatitis -1.700 0.005
adult high grade glioma -3.500 0.000
pilocytic astrocytoma -3.200 0.000
non primary Sjogren syndrome sicca -1.400 0.026
psoriasis -1.600 0.000
subependymal giant cell astrocytoma -3.843 0.001
ovarian cancer -1.100 0.000

Gene RIF (11)

PMID Text
22424243 Decreased SLC1A6 expression in neuregulin 1 risk variant may be an adaptive effect to restore glutamate signalling in schizophrenia patients.
22302796 A twofold difference in functional EAAT4 levels is sufficient to alter signaling to Bergman glia in reporter mice.
21572047 strate-dependent gating of anion channels associated with excitatory amino acid transporter 4.
20519505 a conserved aspartate determines pore properties of anion channels associated with excitatory amino acid transporter 4 (EAAT4)
20424473 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
17442044 conclusion, maximal glutamate transport modulation by SGK1 is accomplished by direct EAAT4 stimulation and to a lesser extent by inhibition of intrinsic Nedd4-2.
17360917 Independent, rather than cooperative anion conductance gating significantly alters predictions of the influence that EAAT4-mediated anion currents will have on synaptic transmission at low glutamate concentrations.
17221839 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSSHGNSLFLRESGQRLGRVGWLQRLQESLQQRALRTRLRLQTMTLEHVLRFLRRNAFILLTVSAVVIGV      1 - 70
SLAFALRPYQLTYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMASLDNKATGRMGMRAAVYYMVTTI     71 - 140
IAVFIGILMVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRT    141 - 210
MVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGLVVFSVAFGL    211 - 280
VIGGMKHKGRVLRDFFDSLNEAIMRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGL    281 - 350
FLHAGIVLPLIYFLVTHRNPFPFIGGMLQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLPVGA    351 - 420
TVNMDGTALYEALAAIFIAQVNNYELNLGQITTISITATAASVGAAGIPQAGLVTMVIVLTSVGLPTEDI    421 - 490
TLIIAVDWFLDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLGKPYKSLMAQEKGASRGRGGN    491 - 560
ESAM                                                                      561 - 564
//

Text Mined References (17)

PMID Year Title
22424243 2013 Gene expression of glutamate transporters SLC1A1, SLC1A3 and SLC1A6 in the cerebellar subregions of elderly schizophrenia patients and effects of antipsychotic treatment.
22302796 2012 Neuronal glutamate transporters regulate glial excitatory transmission.
21572047 2011 Substrate-dependent gating of anion channels associated with excitatory amino acid transporter 4.
20519505 2010 A conserved aspartate determines pore properties of anion channels associated with excitatory amino acid transporter 4 (EAAT4).
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
17442044 2007 EAAT4 phosphorylation at the SGK1 consensus site is required for transport modulation by the kinase.
17360917 2007 The glutamate-activated anion conductance in excitatory amino acid transporters is gated independently by the individual subunits.
17221839 2007 Association study of polymorphisms in the glutamate transporter genes SLC1A1, SLC1A3, and SLC1A6 with schizophrenia.
More...