Property Summary

NCBI Gene PubMed Count 17
PubMed Score 75.79
PubTator Score 42.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -3.000 3.6e-05
astrocytic glioma -2.000 8.2e-03
Astrocytoma, Pilocytic -2.600 7.9e-07
Atopic dermatitis -1.700 4.8e-03
atypical teratoid / rhabdoid tumor -1.800 2.1e-04
cutaneous lupus erythematosus -1.100 2.5e-03
ependymoma -2.400 1.1e-02
glioblastoma -1.600 1.3e-02
group 3 medulloblastoma -3.200 1.2e-04
medulloblastoma, large-cell -3.400 1.5e-06
non primary Sjogren syndrome sicca -1.400 2.6e-02
ovarian cancer -1.100 4.9e-05
primitive neuroectodermal tumor -2.200 2.0e-02
psoriasis -1.100 1.8e-10
subependymal giant cell astrocytoma -2.785 5.0e-03

 MGI Phenotype (1)

Gene RIF (12)

AA Sequence

MSSHGNSLFLRESGQRLGRVGWLQRLQESLQQRALRTRLRLQTMTLEHVLRFLRRNAFILLTVSAVVIGV      1 - 70
SLAFALRPYQLTYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMASLDNKATGRMGMRAAVYYMVTTI     71 - 140
IAVFIGILMVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRT    141 - 210
MVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGLVVFSVAFGL    211 - 280
VIGGMKHKGRVLRDFFDSLNEAIMRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGL    281 - 350
FLHAGIVLPLIYFLVTHRNPFPFIGGMLQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLPVGA    351 - 420
TVNMDGTALYEALAAIFIAQVNNYELNLGQITTISITATAASVGAAGIPQAGLVTMVIVLTSVGLPTEDI    421 - 490
TLIIAVDWFLDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLGKPYKSLMAQEKGASRGRGGN    491 - 560
ESAM                                                                      561 - 564
//

Text Mined References (18)

PMID Year Title