Property Summary

NCBI Gene PubMed Count 36
PubMed Score 666.62
PubTator Score 76.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Breast cancer 1.200 2.2e-03
astrocytic glioma -1.600 1.9e-02
Astrocytoma, Pilocytic -1.800 1.4e-05
colon cancer 2.800 1.5e-04
cystic fibrosis 1.001 1.0e-04
cystic fibrosis and chronic rhinosinusit... 1.150 3.1e-02
ependymoma -2.000 9.5e-03
group 3 medulloblastoma 1.500 4.6e-02
intraductal papillary-mucinous adenoma (... 1.200 1.6e-02
intraductal papillary-mucinous carcinoma... 2.500 2.9e-03
intraductal papillary-mucinous neoplasm ... 4.600 8.8e-05
lung adenocarcinoma 1.600 1.0e-04
malignant mesothelioma -3.500 4.6e-09
nasopharyngeal carcinoma -1.300 2.0e-03
non-small cell lung cancer 2.809 1.7e-13
oligodendroglioma -1.700 1.9e-02
ovarian cancer 1.300 1.5e-02
pancreatic cancer 2.900 6.1e-07
psoriasis 1.300 6.5e-07
ulcerative colitis 1.300 3.6e-03

Gene RIF (18)

AA Sequence

MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDS      1 - 70
QPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMK     71 - 140
RFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI                                        141 - 174
//

Text Mined References (36)

PMID Year Title