Property Summary

NCBI Gene PubMed Count 30
PubMed Score 637.49
PubTator Score 76.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
non-small cell lung cancer 2798 1.69769461194767E-13
malignant mesothelioma 3163 4.57590366789905E-9
pancreatic cancer 2300 6.09347411129816E-7
psoriasis 6685 6.53110622490719E-7
pilocytic astrocytoma 3086 7.67374168267514E-6
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.78817722815052E-5
lung adenocarcinoma 2714 1.02161840463466E-4
colon cancer 1475 1.48141267159372E-4
sonic hedgehog group medulloblastoma 1482 7.98767204627054E-4
nasopharyngeal carcinoma 1056 0.00195658500309634
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00294751353463471
ulcerative colitis 2087 0.00360520642250644
ependymoma 2514 0.00948496600651726
ovarian cancer 8492 0.0145243867977977
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0156028597172133
oligodendroglioma 2849 0.0189128786589106
astrocytic glioma 2241 0.0189224534838445
cystic fibrosis and chronic rhinosinusitis 213 0.030549699725336
Disease Target Count Z-score Confidence
Breast cancer 3099 4.798 2.4

Expression

Synonym

Accession P48645
Symbols

Gene

NMU

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (14)

PMID Text
25871004 polymorphisms in the gene may be useful in identifying women at risk for osteoporosis.
24876102 our results defined NmU as a candidate drug response biomarker for HER2-overexpressing cancers and as a candidate therapeutic target to limit metastatic progression and improve the efficacy of HER-targeted drugs.
23936460 a role for NMU gene through interaction with ADRB2 gene in bone strength regulation
21791076 Inactivation of the von Hippel-Lindau tumour suppressor gene induces Neuromedin U expression in renal cancer cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19519756 [review] Taken together with its vascular actions, NMU may be a functional link between energy balance and the cardiovascular system and may provide a future target for therapies directed against the disorders that comprise metabolic syndrome.
19118941 NmU may be involved in the HGF-c-Met paracrine loop regulating cell migration, invasiveness and dissemination of pancreatic ductal adenocarcinoma.
17018595 NMU & its cancer-specific receptors, as well as its target genes, are frequently overexpressed in clinical samples of lung cancer and in cell lines, and that those gene products play indispensable roles in the growth and progression of lung cancer cells.
16984985 Observational study of gene-disease association. (HuGE Navigator)
16984985 Amino acid variants in NMU associate with overweight and obesity, suggesting that NMU is involved in energy regulation in humans.
More...

AA Sequence

MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDS      1 - 70
QPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMK     71 - 140
RFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI                                        141 - 174
//

Text Mined References (30)

PMID Year Title
26204509 2015 Small lipidated anti-obesity compounds derived from neuromedin U.
25871004 2015 Polymorphisms in neuropeptide genes and bone mineral density in Korean postmenopausal women.
25605682 2015 Neuromedin U: a multifunctional neuropeptide with pleiotropic roles.
25521062 2015 Synthesis and evaluation of novel lipidated neuromedin U analogs with increased stability and effects on food intake.
25416956 2014 A proteome-scale map of the human interactome network.
24876102 2014 Neuromedin U: a candidate biomarker and therapeutic target to predict and overcome resistance to HER-tyrosine kinase inhibitors.
24222478 2014 Development of a neuromedin U-human serum albumin conjugate as a long-acting candidate for the treatment of obesity and diabetes. Comparison with the PEGylated peptide.
23936460 2013 Understanding the links among neuromedin U gene, beta2-adrenoceptor gene and bone health: an observational study in European children.
22771182 2012 PEGylation of Neuromedin U yields a promising candidate for the treatment of obesity and diabetes.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
More...