Property Summary

NCBI Gene PubMed Count 53
PubMed Score 27.77
PubTator Score 12.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Neuropathy 261 0.0 4.0

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 3.200 3.2e-02
group 3 medulloblastoma 1.100 4.6e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.5e-02
invasive ductal carcinoma 1.100 1.6e-03
lung cancer 1.300 1.4e-02
medulloblastoma, large-cell 1.100 4.3e-04
non-small cell lung cancer 1.352 6.0e-21
ovarian cancer 1.100 1.5e-02
psoriasis -1.400 2.4e-04

Gene RIF (10)

AA Sequence

MASMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTV      1 - 70
TNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQA     71 - 140
ARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIK    141 - 210
VEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKY    211 - 280
EKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTA    281 - 350
EKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVY    351 - 420
GGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALG    421 - 490
IDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE                       491 - 541
//

Text Mined References (63)

PMID Year Title