Property Summary

NCBI Gene PubMed Count 52
Grant Count 7
Funding $989,208
PubMed Score 24.54
PubTator Score 12.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.400 0.000
medulloblastoma, large-cell 1.100 0.000
non-small cell lung cancer 1.352 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.015
lung cancer 1.900 0.000
Breast cancer 3.200 0.032
group 3 medulloblastoma 1.100 0.000
invasive ductal carcinoma 1.100 0.002
ovarian cancer 1.100 0.015

Synonym

Accession P48643 A8JZY8 A8K2X8 B4DYD8 TCP-1-epsilon
Symbols CCTE
HEL-S-69
PNAS-102
CCT-epsilon
TCP-1-epsilon

Gene

PANTHER Protein Class (2)

Gene RIF (9)

PMID Text
25995452 CCT5 complex caps mutant mHTT fibrils at their tips and encapsulates mHTT oligomers, providing a structural description of the inhibition of mHTTQ46-Ex1 by CCT5 complex and a shared mechanism of mHTT inhibition between TRiC chaperonin and the CCT5 complex
25124038 H147R CCT5 was not as efficient in chaperoning these substrates as wild type CCT5.
23612981 Both CCT4 and CCT5 homo-oligomers have the property of forming 8-fold double rings absent the other subunits, and these complexes carry out chaperonin reactions without other partner subunits.
22232265 introduction of the truncated human CCT epsilon subunit into yeast cells
20468064 Observational study of gene-disease association. (HuGE Navigator)
19651702 Observational study of gene-disease association. (HuGE Navigator)
18421076 Observational study of gene-disease association. (HuGE Navigator)
16821082 mRNA expression of CCT5, RGS3, and YKT6 was significantly up-regulated in p53-mutated tumors and associated with a low response rate to docetaxel.
16399879 A missense mutation within the CCT5 gene is associated with autosomal recessive mutilating sensory neuropathy with spastic paraplegia.

AA Sequence

MASMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTV      1 - 70
TNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQA     71 - 140
ARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIK    141 - 210
VEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKY    211 - 280
EKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTA    281 - 350
EKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVY    351 - 420
GGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALG    421 - 490
IDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE                       491 - 541
//

Text Mined References (61)

PMID Year Title
25995452 2015 Structural Mechanisms of Mutant Huntingtin Aggregation Suppression by the Synthetic Chaperonin-like CCT5 Complex Explained by Cryoelectron Tomography.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25345891 2014 A human CCT5 gene mutation causing distal neuropathy impairs hexadecamer assembly in an archaeal model.
25329145 2014 Antibody-validated proteins in inflamed islets of fulminant type 1 diabetes profiled by laser-capture microdissection followed by mass spectrometry.
25124038 2014 Biochemical characterization of mutants in chaperonin proteins CCT4 and CCT5 associated with hereditary sensory neuropathy.
24375412 2014 Programmed cell death protein 5 interacts with the cytosolic chaperonin containing tailless complex polypeptide 1 (CCT) to regulate ?-tubulin folding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23897027 2013 Hereditary spastic paraplegia: clinico-pathologic features and emerging molecular mechanisms.
More...