Property Summary

NCBI Gene PubMed Count 53
Grant Count 82
R01 Count 29
Funding $12,638,152.02
PubMed Score 568.93
PubTator Score 238.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P48637 B2R697 B6F210 E1P5P9 Q4TTD9 GSH synthetase
Symbols GSHS
HEL-S-64p
HEL-S-88n

Gene

GSS

PANTHER Protein Class (1)

PDB

2HGS  

 MGI Term (1)

Gene RIF (29)

PMID Text
26059756 GCLC and GSS were expressed at higher levels in colon cancer tissue, as compared with normal mucosa.
25851806 In this study, clinical, biochemical, and genetic aspects of five Chinese 5-oxoprolinuria patients with OPLAH or GSS gene mutations were investigated.
25851338 Four SNPs (rs7265992, rs6060124, rs7260770, and rs4911455) in GSS were significantly associated with bladder cancer recurrence after transurethral resection and BCG treatment.
25070563 Studied the role of protein-protein interactions in the structural stability, activity and allostery of enzymes using the obligate homodimer human glutathione synthetase as an ideal model.
24480751 Exposure to HIV-1 clade B Tat protein has a greater inhibition of GSS, GPx1, SOD1, and CAT expression compared with exposure to clade C Tat protein in monocyte-derived immature dendritic cells
24323765 Its depletion causes protein oxidization in ATL cells.
21771585 The findings indicate that Asp458 is essential for hGS catalysis and that it impacts the allostery of hGS.
21683691 These results imply that residues V44 and V45 are integral to the stability of human glutathione synthetase.
21105962 SNPs not associted with schizophrenia in Japanese individuals
20802163 We have shown that susceptibility to health effects of air pollution on lung function growth is associated with genetic variation in the GSS gene
More...

AA Sequence

MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPFTLFPSLVPSALLEQAYAVQM      1 - 70
DFNLLVDAVSQNAAFLEQTLSSTIKQDDFTARLFDIHKQVLKEGIAQTVFLGLNRSDYMFQRSADGSPAL     71 - 140
KQIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALGIAKAWELYGSPNALVLLIA    141 - 210
QEKERNIFDQRAIENELLARNIHVIRRTFEDISEKGSLDQDRRLFVDGQEIAVVYFRDGYMPRQYSLQNW    211 - 280
EARLLLERSHAAKCPDIATQLAGTKKVQQELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEEGDQA    281 - 350
IAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVV    351 - 420
QCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV                    421 - 474
//

Text Mined References (59)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26059756 2015 Involvement of glutathione and glutathione metabolizing enzymes in human colorectal cancer cell lines and tissues.
25851806 2015 Five Chinese patients with 5-oxoprolinuria due to glutathione synthetase and 5-oxoprolinase deficiencies.
25851338 2015 Genetic Variations in Glutathione Pathway Genes Predict Cancer Recurrence in Patients Treated with Transurethral Resection and Bacillus Calmette-Guerin Instillation for Non-muscle Invasive Bladder Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25070563 2014 The role of strong electrostatic interactions at the dimer interface of human glutathione synthetase.
24323765 2014 Carnosol, rosemary ingredient, induces apoptosis in adult T-cell leukemia/lymphoma cells via glutathione depletion: proteomic approach using fluorescent two-dimensional differential gel electrophoresis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...