Property Summary

NCBI Gene PubMed Count 54
PubMed Score 592.79
PubTator Score 238.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Congenital hemolytic anemia 32 0.0 4.0

Expression

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (30)

AA Sequence

MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPFTLFPSLVPSALLEQAYAVQM      1 - 70
DFNLLVDAVSQNAAFLEQTLSSTIKQDDFTARLFDIHKQVLKEGIAQTVFLGLNRSDYMFQRSADGSPAL     71 - 140
KQIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALGIAKAWELYGSPNALVLLIA    141 - 210
QEKERNIFDQRAIENELLARNIHVIRRTFEDISEKGSLDQDRRLFVDGQEIAVVYFRDGYMPRQYSLQNW    211 - 280
EARLLLERSHAAKCPDIATQLAGTKKVQQELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEEGDQA    281 - 350
IAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVV    351 - 420
QCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV                    421 - 474
//

Text Mined References (61)

PMID Year Title