Property Summary

NCBI Gene PubMed Count 12
Grant Count 9
R01 Count 7
Funding $626,922.26
PubMed Score 94.56
PubTator Score 26.12

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
22465717 DGCR2, GPR44 and SerpinB10, found in beta cells, were negative in all other cell types within pancreas and exposed epitopes at the cell surface
20433722 Bomapin is a redox-sensitive nuclear serpin that augments proliferation or apoptosis of leukaemia cells, depending on growth factors availability.
16172807 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDSLATSINQFALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVLQFNRDQGVKCDP      1 - 70
ESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEPQP     71 - 140
VNFVEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRIN    141 - 210
ETTSKPVQMMFMKKKLHIFHIEKPKAVGLQLYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSAD    211 - 280
MMELYEVQLHLPKFKLEDSYDLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTE    281 - 350
AAAGSGSEIDIRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP                           351 - 397
//

Text Mined References (12)

PMID Year Title
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
22465717 2012 Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20433722 2010 Bomapin is a redox-sensitive nuclear serpin that affects responsiveness of myeloid progenitor cells to growth environment.
16172807 2005 Nucleotide variations in genes encoding plasminogen activator inhibitor-2 and serine proteinase inhibitor B10 associated with prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10871600 2000 Protease inhibitor 10 inhibits tumor necrosis factor alpha -induced cell death. Evidence for the formation of intracellular high M(r) protease inhibitor 10-containing complexes.
10196205 1999 Identification of a nuclear targeting domain in the insertion between helices C and D in protease inhibitor-10.
9268635 1997 Cytoplasmic antiproteinase 2 (PI8) and bomapin (PI10) map to the serpin cluster at 18q21.3.
More...