Property Summary

NCBI Gene PubMed Count 49
Grant Count 15
R01 Count 5
Funding $1,029,045.11
PubMed Score 95.80
PubTator Score 63.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
uncontrolled asthma 1.600 0.002
non-small cell lung carcinoma 1.100 0.001
psoriasis 7.200 0.000

Gene RIF (32)

PMID Text
26993499 Data show that oropharyngeal squamous cell carcinomas (OPSCCs) express granzyme inhibitors SERPINB1, SERPINB4 and SERPINB9 for cytotoxicity and the expression was not different between human papillomavirus (HPV)-positive and HPV-negative tumors.
26963506 Pediatric CNS-PNETs evade immune recognition by downregulating cell surface MHC-I and CD1d expression. Intriguingly, expression of SERPINB9, SERPINB1, and SERPINB4 is acquired during tumorigenesis in 29%, 29%, and 57% of the tumors
25213322 our findings established that SCCA1 contributes to tumorigenesis by promoting EMT and a UPR-dependent induction of NF-kappaB and IL6 autocrine signaling that promotes a protumorigenic inflammation.
25111616 Silencing of SERPINB3/B4 in human keratinocytes decreased S100A8 expression, supporting a role for SERPINB3/B4 in the initiation of the acute inflammatory response.
24898082 we identified four proteins with different expression in paclitaxel resistant cells, i.e., serpin B3, serpin B4, heat shock protein 27 (all three upregulated) and cytokeratin 18 (downregulated).
24635038 It is a promising serological marker for hepatocellular carcinoma.
24560885 demonstrate the generation of Pso p27 from SCCA1 with extracts from psoriatic scale and even more remarkably, the generation of Pso p27 from SCCA1 in the presence of mast cell associated chymase
23199842 The results show that SCCA1 has diverse effects on many of the cellular events that characterize asthma and its role extends beyond protease inhibition.
23168150 The serum level of SCCA is effective for detecting inverted papilloma (IP), including recurrent IP. In contrast, the SCCA2/SCCA1 ratio is useful for detecting squamous cell carcinoma among other sinonasal diseases.
22937809 both HPV status and the SCCA2/SCCA1 mRNA ratio are independently associated with prognosis in HNSCC
More...

AA Sequence

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKA      1 - 70
ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTSVESTDFANAP     71 - 140
EESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV    141 - 210
QMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCV    211 - 280
DLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVV    281 - 350
VVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP                                  351 - 390
//

Text Mined References (50)

PMID Year Title
26993499 2016 Oropharyngeal squamous cell carcinomas differentially express granzyme inhibitors.
26963506 2016 Pediatric Primitive Neuroectodermal Tumors of the Central Nervous System Differentially Express Granzyme Inhibitors.
25213322 2014 SCCA1/SERPINB3 promotes oncogenesis and epithelial-mesenchymal transition via the unfolded protein response and IL6 signaling.
25111616 2015 SERPINB3/B4 contributes to early inflammation and barrier dysfunction in an experimental murine model of atopic dermatitis.
24898082 2014 Differentially expressed proteins in human breast cancer cells sensitive and resistant to paclitaxel.
24635038 2014 Diagnostic and prognostic role of SCCA-IgM serum levels in hepatocellular carcinoma (HCC).
24560885 2014 Psoriasis pathogenesis - Pso p27 is generated from SCCA1 with chymase.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...