Property Summary

NCBI Gene PubMed Count 52
PubMed Score 100.72
PubTator Score 63.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Dermatitis, Contact 71 0.0 0.0
Disease Target Count P-value
psoriasis 6694 8.6e-133
non-small cell lung carcinoma 317 1.4e-03
uncontrolled asthma 56 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung carcinoma 1.100 1.4e-03
psoriasis 7.200 8.6e-133
uncontrolled asthma 1.600 2.0e-03

Gene RIF (34)

AA Sequence

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKA      1 - 70
ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTSVESTDFANAP     71 - 140
EESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV    141 - 210
QMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCV    211 - 280
DLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVV    281 - 350
VVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP                                  351 - 390
//

Text Mined References (53)

PMID Year Title