Property Summary

NCBI Gene PubMed Count 42
PubMed Score 20.60
PubTator Score 27.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.218 0.001
glioblastoma 1.100 0.016
pancreatic ductal adenocarcinoma liver m... -1.093 0.037
non primary Sjogren syndrome sicca 1.600 0.015
ovarian cancer 2.100 0.000

Synonym

Accession P48556 B4DX18 Q6P1L7
Symbols S14
p31
HIP6
HYPF
Nin1p
Rpn12
HEL-S-91n

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   5L4K  

Gene RIF (28)

PMID Text
16885229 These findings support the hypothesis that neurodegenerative disorders result primarily from a generic cell dysfunction caused by early misfolded species in the aggregation process.
14614829 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14564014 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14557625 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14550573 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14550573 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14528301 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14528300 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14527406 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12970355 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
More...

AA Sequence

MFIKGRAPRAPPRERRRATRGGLRQVVAPPRALGSTSRPHFRRASVCRRRCRKSGGLLAASRKMAAAAVN      1 - 70
GAAGFSSSGPAATSGAVLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQ     71 - 140
LILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHT    141 - 210
ELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYE    211 - 280
KILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV    281 - 350
//

Text Mined References (45)

PMID Year Title
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
16885229 2006 Prefibrillar amyloid aggregates could be generic toxins in higher organisms.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...