Property Summary

NCBI Gene PubMed Count 42
PubMed Score 20.60
PubTator Score 27.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
HIV Infections 100
Disease Target Count P-value
ovarian cancer 8492 1.22268859491125E-5
Multiple myeloma 1328 5.6290385813228E-4
non primary Sjogren syndrome sicca 840 0.0148238757222572
glioblastoma 5572 0.0160632237626943
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0370950906417798

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.218 0.001
glioblastoma 1.100 0.016
pancreatic ductal adenocarcinoma liver m... -1.093 0.037
non primary Sjogren syndrome sicca 1.600 0.015
ovarian cancer 2.100 0.000

Synonym

Accession P48556 B4DX18 Q6P1L7
Symbols S14
p31
HIP6
HYPF
Nin1p
Rpn12
HEL-S-91n

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   5L4K  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (25)

PMID Text
16885229 These findings support the hypothesis that neurodegenerative disorders result primarily from a generic cell dysfunction caused by early misfolded species in the aggregation process.
14614829 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14564014 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14557625 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14550573 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14528301 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14528300 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14527406 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12970355 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12920286 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
More...

AA Sequence

MFIKGRAPRAPPRERRRATRGGLRQVVAPPRALGSTSRPHFRRASVCRRRCRKSGGLLAASRKMAAAAVN      1 - 70
GAAGFSSSGPAATSGAVLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQ     71 - 140
LILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHT    141 - 210
ELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYE    211 - 280
KILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV    281 - 350
//

Text Mined References (45)

PMID Year Title
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
16885229 2006 Prefibrillar amyloid aggregates could be generic toxins in higher organisms.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...