Property Summary

NCBI Gene PubMed Count 42
PubMed Score 24.66
PubTator Score 27.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.100 1.6e-02
Multiple myeloma 1.218 5.6e-04
non primary Sjogren syndrome sicca 1.600 1.5e-02
ovarian cancer 2.100 1.2e-05
pancreatic ductal adenocarcinoma liver m... -1.093 3.7e-02

Synonym

Accession P48556 B4DX18 Q6P1L7
Symbols S14
p31
HIP6
HYPF
Nin1p
Rpn12
HEL-S-91n

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   5LN3   5M32   5T0C   5T0G   5T0H   5T0I   5T0J   5VGZ   5VHF   5VHH   5VHI   5VHS   5L4K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (25)

AA Sequence

MFIKGRAPRAPPRERRRATRGGLRQVVAPPRALGSTSRPHFRRASVCRRRCRKSGGLLAASRKMAAAAVN      1 - 70
GAAGFSSSGPAATSGAVLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQ     71 - 140
LILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHT    141 - 210
ELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYE    211 - 280
KILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV    281 - 350
//

Text Mined References (49)

PMID Year Title