Property Summary

NCBI Gene PubMed Count 84
Grant Count 77
R01 Count 58
Funding $6,830,980.94
PubMed Score 170.61
PubTator Score 110.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 3.600 0.000
gastric cancer -1.400 0.043
hepatocellular carcinoma -1.200 0.006
Waldenstrons macroglobulinemia -1.727 0.016
chronic lymphosyte leukemia -1.800 0.000
malignant mesothelioma -2.700 0.000
astrocytic glioma 2.300 0.014
oligodendroglioma 2.000 0.037
osteosarcoma 3.403 0.000
cystic fibrosis 1.052 0.000
glioblastoma 1.600 0.001
atypical teratoid / rhabdoid tumor -2.600 0.000
group 4 medulloblastoma 1.800 0.009
medulloblastoma, large-cell 1.900 0.001
primitive neuroectodermal tumor 1.400 0.007
Crohn's disease -1.215 0.001
ulcerative colitis -1.485 0.005
hereditary spastic paraplegia -1.229 0.004
juvenile dermatomyositis 1.024 0.000
Amyotrophic Lateral Sclerosis 1.306 0.000
acute quadriplegic myopathy 1.396 0.002
lung cancer -3.000 0.001
sarcoidosis 1.500 0.046
pediatric high grade glioma 1.400 0.010
aldosterone-producing adenoma -1.266 0.031
Pick disease 1.700 0.000
ovarian cancer 1.500 0.001

Synonym

Accession P48552 Q8IWE8
Symbols RIP140

Gene

PDB

4S14   2GPO   2GPP   4S15  

 GWAS Trait (1)

Gene RIF (45)

PMID Text
26492163 Data indicate that nuclear receptor interacting protein 1 (NRIP1) is elevated in tumors compared to cancer adjacent normal tissue.
26469385 HIV-1 MA upregulates NRIP1 gene expression in HepG2 cells
26213846 NOP14 suppresses breast cancer progression by inhibiting NRIP1/Wnt/beta-catenin pathway.
26116758 RIP140 gene has been shown to be involved in the regulation of energy expenditure, in mammary gland development and intestinal homeostasis as well as in behavior and cognition
25845235 The associations of rs2616984 in CSMD1 gene, putative associations of rs3131296 in NOTCH4 gene, and associations of rs2229741 of NRIP1 gene with Alzheimer's disease have been found in a Russian population.
25616132 RIP140 negatively regulated the macrophage expression of ATP-binding cassette transporters A1 and G1.
25391428 Downregulation of RIP140 promoted the tumorigenicity of HCC cells in vitro.
25218501 In breast cancer cells, GSTP1 inhibits the expression of RIP140, a negative regulator of estrogen receptor alpha transcription, at both mRNA and protein levels.
25145671 data suggest that RIP140 plays an important role in ERalpha-mediated transcriptional regulation in breast cancer and response to tamoxifen treatment
24975273 Data suggest that vitamin D receptor target genes (NRIP1; DUSP10, dual specificity phosphatase 10; THBD, thrombomodulin; TRAK1, trafficking protein kinesin binding 1) can be used as markers for individual's response to vitamin D3 supplements.
More...

AA Sequence

MTHGEELGSDVHQDSIVLTYLEGLLMHQAAGGSGTAVDKKSAGHNEEDQNFNISGSAFPTCQSNGPVLNT      1 - 70
HTYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIMNLNVKKEALLAGMVDSVPKGKQDSTLLASLLQSF     71 - 140
SSRLQTVALSQQIRQSLKEQGYALSHDSLKVEKDLRCYGVASSHLKTLLKKSKVKDQKPDTNLPDVTKNL    141 - 210
IRDRFAESPHHVGQSGTKVMSEPLSCAARLQAVASMVEKRASPATSPKPSVACSQLALLLSSEAHLQQYS    211 - 280
REHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPM    281 - 350
GIIPSSPKNAGYKNSLERNNIKQAANNSLLLHLLKSQTIPKPMNGHSHSERGSIFEESSTPTTIDEYSDN    351 - 420
NPSFTDDSSGDESSYSNCVPIDLSCKHRTEKSESDQPVSLDNFTQSLLNTWDPKVPDVDIKEDQDTSKNS    421 - 490
KLNSHQKVTLLQLLLGHKNEENVEKNTSPQGVHNDVSKFNTQNYARTSVIESPSTNRTTPVSTPPLLTSS    491 - 560
KAGSPINLSQHSLVIKWNSPPYVCSTQSEKLTNTASNHSMDLTKSKDPPGEKPAQNEGAQNSATFSASKL    561 - 630
LQNLAQCGMQSSMSVEEQRPSKQLLTGNTDKPIGMIDRLNSPLLSNKTNAVEENKAFSSQPTGPEPGLSG    631 - 700
SEIENLLERRTVLQLLLGNPNKGKSEKKEKTPLRDESTQEHSERALSEQILMVKIKSEPCDDLQIPNTNV    701 - 770
HLSHDAKSAPFLGMAPAVQRSAPALPVSEDFKSEPVSPQDFSFSKNGLLSRLLRQNQDSYLADDSDRSHR    771 - 840
NNEMALLESKNLCMVPKKRKLYTEPLENPFKKMKNNIVDAANNHSAPEVLYGSLLNQEELKFSRNDLEFK    841 - 910
YPAGHGSASESEHRSWARESKSFNVLKQLLLSENCVRDLSPHRSNSVADSKKKGHKNNVTNSKPEFSISS    911 - 980
LNGLMYSSTQPSSCMDNRTFSYPGVVKTPVSPTFPEHLGCAGSRPESGLLNGCSMPSEKGPIKWVITDAE    981 - 1050
KNEYEKDSPRLTKTNPILYYMLQKGGNSVTSRETQDKDIWREASSAESVSQVTAKEELLPTAETKASFFN   1051 - 1120
LRSPYNSHMGNNASRPHSANGEVYGLLGSVLTIKKESE                                   1121 - 1158
//

Text Mined References (88)

PMID Year Title
26492163 2015 Suppressing NRIP1 inhibits growth of breast cancer cells in vitro and in vivo.
26213846 2015 NOP14 suppresses breast cancer progression by inhibiting NRIP1/Wnt/?-catenin pathway.
26116758 2015 The emerging role of the transcriptional coregulator RIP140 in solid tumors.
25845235 [Replicative association analysis of genetic markers of cognitive traits with Alzheimer's disease in a Russian population].
25616132 2015 RIP140 triggers foam-cell formation by repressing ABCA1/G1 expression and cholesterol efflux via liver X receptor.
25416956 2014 A proteome-scale map of the human interactome network.
25391428 2015 Downregulation of RIP140 in hepatocellular carcinoma promoted the growth and migration of the cancer cells.
25218501 2014 Human glutathione S-transferase P1-1 functions as an estrogen receptor ? signaling modulator.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25145671 2014 Complex formation and function of estrogen receptor ? in transcription requires RIP140.
More...