Property Summary

Ligand Count 5
NCBI Gene PubMed Count 97
PubMed Score 79.46
PubTator Score 98.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 5.1e-07
atypical teratoid / rhabdoid tumor -1.200 7.6e-04
cutaneous lupus erythematosus 1.500 9.8e-03
gastric carcinoma 1.300 4.0e-02
glioblastoma 1.100 3.2e-05
group 4 medulloblastoma -1.100 2.9e-02
intraductal papillary-mucinous neoplasm ... 1.200 5.5e-03
lung cancer -1.400 7.4e-04
medulloblastoma, large-cell -1.500 1.7e-05
osteosarcoma -1.916 1.0e-04
ovarian cancer 1.900 4.2e-06
pancreatic ductal adenocarcinoma liver m... 1.266 1.2e-02
Pick disease 1.400 2.8e-07
psoriasis -1.300 2.4e-04
Rheumatoid arthritis 1.200 8.8e-03

Protein-protein Interaction (1)

Gene RIF (72)

AA Sequence

MLLSQNAFIFRSLNLVLMVYISLVFGISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLY      1 - 70
TIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFE     71 - 140
IVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSV    141 - 210
YLEHSDEQAVIKSPLKCTLLPPGQESESAESAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSLPKVL    211 - 280
NFHNFLAWPFPNLPPLEAMDMVEVIYINRKKKVWDYNYDDESDSDTEAAPRTSGGGYTMHGLTVRPLGQA    281 - 350
SATSTESQLIDPESEEEPDLPEVDVELPTMPKDSPQQLELLSGPCERRKSPLQDPFPEEDYSSTEGSGGR    351 - 420
ITFNVDLNSVFLRVLDDEDSDDLEAPLMLSSHLEEMVDPEDPDNVQSNHLLASGEGTQPTFPSPSSEGLW    421 - 490
SEDAPSDQSDTSESDVDLGDGYIMR                                                 491 - 515
//

Text Mined References (107)

PMID Year Title