Property Summary

NCBI Gene PubMed Count 95
Grant Count 71
R01 Count 42
Funding $9,911,361.6
PubMed Score 74.00
PubTator Score 98.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.009
cutaneous lupus erythematosus 1.500 0.010
psoriasis -1.300 0.000
osteosarcoma -1.916 0.000
atypical teratoid / rhabdoid tumor -1.200 0.001
glioblastoma 1.100 0.000
medulloblastoma -1.100 0.009
medulloblastoma, large-cell -1.500 0.000
pancreatic ductal adenocarcinoma liver m... 1.266 0.012
intraductal papillary-mucinous neoplasm ... 1.200 0.005
lung cancer -2.600 0.000
pilocytic astrocytoma 1.200 0.000
Pick disease 1.400 0.000
gastric carcinoma 1.300 0.040
ovarian cancer 1.900 0.000

Synonym

Accession P48551 A8KAJ4 D3DSE8 D3DSE9 Q15467 Q6FHD7 IFN-R-2
Symbols IFN-R
IMD45
IFNABR
IFNARB
IFN-alpha-REC

Gene

PDB

2HYM   2KZ1   2LAG   3S9D   3SE3   1N6U   1N6V   3S8W   3SE4  

Gene RIF (70)

PMID Text
26679999 Data suggest IFNA2 (interferon, alpha 2) binding to extracellular domain of IFNAR1 or IFNAR2 promotes proximity between intracellular domains; signaling depends on duration of activation/affinity of binding rather than specific conformational changes.
26176069 Lack of expression of functional IFNAR2 does not seem to be the major cause of interferon resistance in hepatitis C virus patients receiving standard interferon therapy.
26008745 Dimerization of IFNAR1 and IFNAR2 and the limiting role of IFNAR1 binding affinity in complex assembly is modulated by USP18.
25265476 The expression of IFNAR1, IFNgammaR1 and ribovarin transporters were significantly impaired in chronic liver disease and cirrhotic livers.
25072284 A very small percentage of the pancreatic tumors showed strong expression of the IFNAR-2c.
24460759 Therefore, this study associated, for the first time, in a large panel of pancreatic cancer cell lines the effects of IFN-alpha/-beta with the expression of type-I IFN receptors.
23745570 The effects of two functional polymorphisms, type I interferon receptor 2 gene (IFNAR2)-F8S and interleukin-10 receptor subunit beta gene (IL10RB)-K47E, on chronic hepatitis B virus (HBV) infection, were investigated.
23663046 Results suggest that oxidative stress play an important role in the regulation of type I interferon receptors IFNAR1 and IFNAR2 in chronic hepatitis B virus (HBV) infection.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides upregulate gene expression of interferon (alpha, beta and omega) receptor 2 (IFNAR2) in U-937 macrophages
22236545 IFNAR2 overexpression was observed in various histological types of lung cancer, and appears to be associated with lung cancers that behave aggressively.
More...

AA Sequence

MLLSQNAFIFRSLNLVLMVYISLVFGISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLY      1 - 70
TIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFE     71 - 140
IVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSV    141 - 210
YLEHSDEQAVIKSPLKCTLLPPGQESESAESAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSLPKVL    211 - 280
NFHNFLAWPFPNLPPLEAMDMVEVIYINRKKKVWDYNYDDESDSDTEAAPRTSGGGYTMHGLTVRPLGQA    281 - 350
SATSTESQLIDPESEEEPDLPEVDVELPTMPKDSPQQLELLSGPCERRKSPLQDPFPEEDYSSTEGSGGR    351 - 420
ITFNVDLNSVFLRVLDDEDSDDLEAPLMLSSHLEEMVDPEDPDNVQSNHLLASGEGTQPTFPSPSSEGLW    421 - 490
SEDAPSDQSDTSESDVDLGDGYIMR                                                 491 - 515
//

Text Mined References (105)

PMID Year Title
26679999 2016 Type I Interferon Signaling Is Decoupled from Specific Receptor Orientation through Lenient Requirements of the Transmembrane Domain.
26424569 2015 Human IFNAR2 deficiency: Lessons for antiviral immunity.
26176069 2014 Detection of Interferon Alpha Receptor 2 in Interferon Resistant HCV Patients.
26008745 2015 Receptor dimerization dynamics as a regulatory valve for plasticity of type I interferon signaling.
25265476 2014 Impaired expression of type I and type II interferon receptors in HCV-associated chronic liver disease and liver cirrhosis.
25072284 2015 Type I Interferon Receptor Expression in Human Pancreatic and Periampullary Cancer Tissue.
24460759 2014 Influence of type-I Interferon receptor expression level on the response to type-I Interferons in human pancreatic cancer cells.
24075985 2013 A BRISC-SHMT complex deubiquitinates IFNAR1 and regulates interferon responses.
23745570 2013 Association of IFNAR2 and IL10RB genes in chronic hepatitis B virus infection.
23663046 2013 Peripheral type I interferon receptor correlated with oxidative stress in chronic hepatitis B virus infection.
More...