Property Summary

NCBI Gene PubMed Count 40
Grant Count 92
R01 Count 53
Funding $11,920,995.91
PubMed Score 205.47
PubTator Score 114.15

Knowledge Summary

Patent (12,933)

Expression

Synonym

Accession P48549 B4DEW7 Q8TBI0 GIRK-1
Symbols KGA
GIRK1
KIR3.1

Gene

Gene RIF (19)

PMID Text
25599232 The findings of this study suggest that variations in KCNJ3 genes are associated with both mild and severe persistent breast pain after breast cancer surgery.
24392765 For KCNJ3 rs7574878, individuals who were heterozygous or homozygous for the rare G allele (TT versus TG+ GG) had a 48% reduction in the odds of reporting preoperative breast pain.
23368630 we show that Kir3.1, in the absence of trafficking partner subunits, can exit the endoplasmic reticulum (ER) and reach the Golgi (though not the plasma membrane)
23219908 In the dorsal horn of the developing rat, K(ir)3.1 and K(ir)3.2 were expressed at mature levels from birth.
23175530 Conformational changes at the Gbetagamma/Kir3 interface were lost when Kir3.1 subunits were replaced.
21927946 These data suggest that the KCNJ3 gene is genetically associated with schizophrenia in Asian populations and add further evidence to the "channelopathy theory of psychiatric illnesses".
21420934 Kir3.1 channel is involved in the TLR4-mediated signal at an early event by facilitating the recruitment of TLR4 into lipid raft.
21044958 halothane predominantly interferes with Gbetagamma-mediated Kir3 currents, such as those functioning during inhibitory synaptic activity
20512921 The very high abundance of mRNA's encoding GIRK1 together with the presence of GIRK1 protein suggests a pathophysiological role in breast cancer
20468064 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSD      1 - 70
LFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIET     71 - 140
EATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLT    141 - 210
LMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPF    211 - 280
YDLSQRSMQTEQFEIVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFE    281 - 350
VPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS    351 - 420
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGAARMEGNLPA    421 - 490
KLRKMNSDRFT                                                               491 - 501
//

Text Mined References (42)

PMID Year Title
25599232 2015 Variations in potassium channel genes are associated with distinct trajectories of persistent breast pain after breast cancer surgery.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24392765 Variations in potassium channel genes are associated with breast pain in women prior to breast cancer surgery.
23368630 2013 A novel, radiolabel-free pulse chase strategy to study Kir3 channel ontogeny.
23219908 2013 Transcriptional expression of voltage-gated Na? and voltage-independent K? channels in the developing rat superficial dorsal horn.
23175530 2013 Conformational dynamics of Kir3.1/Kir3.2 channel activation via ?-opioid receptors.
21927946 2012 Association study of the KCNJ3 gene as a susceptibility candidate for schizophrenia in the Chinese population.
21420934 2011 Kir3.1 channel is functionally involved in TLR4-mediated signaling.
21044958 2010 G protein {beta}{gamma} gating confers volatile anesthetic inhibition to Kir3 channels.
20560207 2010 Identification of a Kir3.4 mutation in congenital long QT syndrome.
More...