Property Summary

NCBI Gene PubMed Count 42
PubMed Score 217.25
PubTator Score 114.15

Knowledge Summary

Patent (12,933)

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis 2.268 9.7e-03
adult high grade glioma -2.500 6.3e-04
astrocytic glioma -1.800 1.2e-02
Astrocytoma, Pilocytic -1.500 2.3e-04
atypical teratoid / rhabdoid tumor -3.200 4.5e-09
ependymoma -2.100 1.5e-02
glioblastoma -1.400 1.8e-05
group 3 medulloblastoma -1.600 2.8e-02
lung carcinoma 1.500 2.7e-06
medulloblastoma, large-cell -2.400 7.2e-04
non diabetic and post-ischemic heart fai... 1.200 2.9e-02
oligodendroglioma -2.300 2.6e-02
pituitary cancer -1.300 1.4e-02
primitive neuroectodermal tumor -1.100 7.1e-03
psoriasis -1.800 9.0e-25
subependymal giant cell astrocytoma -1.752 1.3e-02
type II diabetes mellitus and post-ische... 1.400 2.3e-02

Gene RIF (21)

AA Sequence

MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSD      1 - 70
LFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIET     71 - 140
EATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLT    141 - 210
LMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPF    211 - 280
YDLSQRSMQTEQFEIVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFE    281 - 350
VPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS    351 - 420
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGAARMEGNLPA    421 - 490
KLRKMNSDRFT                                                               491 - 501
//

Text Mined References (44)

PMID Year Title