Property Summary

NCBI Gene PubMed Count 25
Grant Count 194
R01 Count 147
Funding $25,452,242.26
PubMed Score 260.85
PubTator Score 108.25

Knowledge Summary

Patent (9,049)

Expression

Synonym

Accession P48547 K4DI87
Symbols KV4
EPM7
NGK2
KV3.1

Gene

Gene RIF (12)

PMID Text
26673941 KCNC1 produces a resurgent current during repolarization, ensuring enough repolarizing power to terminate each action potential. The current results from a combination of steep voltage-dependent gating kinetics and ultra-fast voltage-sensor relaxation.
25401298 A recurrent KCNC1 de novo mutation, c.959G>A (p.Arg320His), is a new major cause for progressive myoclonus epilepsy. It has a dominant-negative loss-of-function effect.
23628987 Findings show a decrease in Kv3.1b channel protein in schizophrenia neocortex, a deficit that is restored by antipsychotic drugs
23576435 KChIP4a suppresses A-type Kv4 current via ER retention and enhancement of Kv4 closed-state inactivation.
22387313 demonstrated that glycosylation was necessary for both DPP10 trafficking to the cell surface and functional interaction with Kv4 channels
21912965 Although all KV3 subunit transcripts are significantly expressed at embryonic age in whole mouse brain extracts, only KV3.1, KV3.2 and KV3.4 subunit transgenic proteins are present.
21106837 Kv3.1 channels are transported into axons by binding to kinesin I.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19332619 In the absence of potassium ion, significant N-methyl-D-glucamine (NMDG)-positive currents could be recorded from human embryonic kidney cells expressing Kv3.1 or Kv3.2b channels and Kv1.5 Arg487Tyr/Val, but not wild-type channels.
More...

AA Sequence

MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY      1 - 70
YRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPG     71 - 140
DSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLE    141 - 210
THERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNI    211 - 280
IDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLII    281 - 350
FLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC    351 - 420
ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPHHSTQSDTCPL    421 - 490
AQEEILEINRAGRKPLRGMSI                                                     491 - 511
//

Text Mined References (26)

PMID Year Title
26673941 2015 Kv3.1 uses a timely resurgent K(+) current to secure action potential repolarization.
25401298 2015 A recurrent de novo mutation in KCNC1 causes progressive myoclonus epilepsy.
24143882 2014 Genome-wide association study of opioid dependence: multiple associations mapped to calcium and potassium pathways.
23734863 2013 Spinocerebellar ataxia-13 Kv3.3 potassium channels: arginine-to-histidine mutations affect both functional and protein expression on the cell surface.
23628987 2014 Kv3.1-containing K(+) channels are reduced in untreated schizophrenia and normalized with antipsychotic drugs.
23576435 2013 Auxiliary KChIP4a suppresses A-type K+ current through endoplasmic reticulum (ER) retention and promoting closed-state inactivation of Kv4 channels.
22387313 2012 N-glycosylation of the mammalian dipeptidyl aminopeptidase-like protein 10 (DPP10) regulates trafficking and interaction with Kv4 channels.
22105078 2012 Alternative splicing regulates kv3.1 polarized targeting to adjust maximal spiking frequency.
21945320 2011 Biochemical engineering of the N-acyl side chain of sialic acids alters the kinetics of a glycosylated potassium channel Kv3.1.
21912965 2012 Brain expression of Kv3 subunits during development, adulthood and aging and in a murine model of Alzheimer's disease.
More...