Property Summary

NCBI Gene PubMed Count 63
Grant Count 7
R01 Count 3
Funding $336,275.74
PubMed Score 71.78
PubTator Score 59.99

Knowledge Summary

Patent (4,460)

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.300 0.000

Gene RIF (42)

PMID Text
26395740 The common variant rs10423928 in the GIPR gene is associated with increased risk of stroke in patients with type 2 diabetes.
26225752 Study shows the internalization of GIPR involving clathrin-coated pits, AP-2 and dynamin and its subsequent intracellular trafficking. GIP stimulates a rapid robust internalization of the GIPR, the major part being directed to lysosomes.
25591947 The potential future role of gastric inhibitory peptide (GIP) receptors as molecular targets in neuroendocrine neoplasms may be dependent on the tumor grade.
25321336 Body mass index change for the A/T+A/A in GIPR genotypes was significantly higher than that for the T/T genotype. rs10423928 may predict weight gain in schizophrenia.
25047836 Results show that GIPR undergoes trafficking between the plasma membrane and intracellular compartments of both GIP-stimulated and unstimulated adipocytes.
24565507 GIPR is overexpressed in gastric and duodenal neuroendocrine tumors
24512489 GIPR expression was downregulated in subcutaneous adipose tissue from obese patients and correlated negatively with body mass index, waist circumference, systolic blood pressure, and glucose and triglyceride levels.
24446656 This study demonstrates an association between a functional GIPR polymorphism Glu354Gln (rs1800437) and Bone mineral density and fracture risk.
24238043 Compared with the current treatment standard SSTR2, GIPR has only somewhat lesser absolute gene expression in tumor tissue but much lesser expression in normal tissue, making it a promising new target for neuroendocrine tumor imaging and therapy.
24086540 GIPR promoter was hypomethylated in type 2 diabetic patients as compared to controls.
More...

AA Sequence

MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVC      1 - 70
WDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVM     71 - 140
YTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSFMLRAAAILSRDRLLPRPGPYLGDQALALWN    141 - 210
QALAACRTAQIVTQYCVGANYTWLLVEGVYLHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYL    211 - 280
YENTQCWERNEVKAIWWIIRTPILMTILINFLIFIRILGILLSKLRTRQMRCRDYRLRLARSTLTLVPLL    281 - 350
GVHEVVFAPVTEEQARGALRFAKLGFEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQ    351 - 420
RQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC                            421 - 466
//

Text Mined References (64)

PMID Year Title
26395740 2016 Glucose-Dependent Insulinotropic Polypeptide Stimulates Osteopontin Expression in the Vasculature via Endothelin-1 and CREB.
26225752 2015 Internalization and desensitization of the human glucose-dependent-insulinotropic receptor is affected by N-terminal acetylation of the agonist.
25591947 2015 Does somatostatin or gastric inhibitory peptide receptor expression correlate with tumor grade and stage in gut neuroendocrine tumors?
25321336 2015 GIPR Gene Polymorphism and Weight Gain in Patients With Schizophrenia Treated With Olanzapine.
25047836 2014 A naturally occurring GIP receptor variant undergoes enhanced agonist-induced desensitization, which impairs GIP control of adipose insulin sensitivity.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24565507 2014 GIPR expression in gastric and duodenal neuroendocrine tumors.
24512489 2014 Disruption of GIP/GIPR axis in human adipose tissue is linked to obesity and insulin resistance.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24446656 2014 A functional amino acid substitution in the glucose-dependent insulinotropic polypeptide receptor (GIPR) gene is associated with lower bone mineral density and increased fracture risk.
More...