Property Summary

NCBI Gene PubMed Count 111
PubMed Score 202.13
PubTator Score 155.34

Knowledge Summary

Patent (24,291)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Long QT syndrome 39 3.218 1.6

Expression

Protein-protein Interaction (12)

Gene RIF (85)

AA Sequence

MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQET      1 - 70
YRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDHVGDQEWIPCVENLSGFVSAF     71 - 140
LFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNNAVISM    141 - 210
RDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEI    211 - 280
NQKSPFWEMSQAQLHQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNT    281 - 350
FHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV     351 - 419
//

Text Mined References (113)

PMID Year Title