Property Summary

NCBI Gene PubMed Count 19
Grant Count 15
R01 Count 12
Funding $782,821.53
PubMed Score 78.30
PubTator Score 35.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Down syndrome -1.100 0.019
astrocytic glioma -2.300 0.001
oligodendroglioma -1.900 0.009
esophageal adenocarcinoma -1.900 0.034
psoriasis -2.100 0.000
cutaneous lupus erythematosus -2.200 0.045
glioblastoma -3.600 0.000
ependymoma -2.100 0.001
sonic hedgehog group medulloblastoma -5.300 0.000
atypical teratoid/rhabdoid tumor -2.000 0.006
medulloblastoma, large-cell -4.800 0.000
primitive neuroectodermal tumor -2.200 0.023
Atopic dermatitis -1.500 0.004
non-small cell lung cancer 1.422 0.000
colon cancer -4.500 0.002
lung cancer 3.300 0.000
lung adenocarcinoma 1.300 0.000
adult high grade glioma -4.100 0.000
pilocytic astrocytoma -3.700 0.000
aldosterone-producing adenoma 2.877 0.010
lung carcinoma 2.100 0.000
Alzheimer's disease -1.200 0.016
Pick disease -1.100 0.003

Gene RIF (9)

PMID Text
25153723 Data indicated that PCP4/PEP19 regulates apoptosis but exact mechanism is still unknown.
24954028 PCP4 protein is highly expressed in the olfactory bulb and caudate putamen and PCP4 expressing cells in the brain are of neuronal origin.
24403568 PCP4 is a regulator of aldosterone production in normal, hyperplastic, and neoplastic human adrenocortical cells.
24291518 This study demonstrate that Pcp4 overexpression extended these effects later in development by modulating genes in line with the maturation of neurons in the cerebellum.
23204517 The calmodulin regulator protein, PEP-19, sensitizes ATP-induced Ca2+ release.
21491429 Data show that Pcp4 overexpression induces precocious neuronal differentiation, and is associated with an increase in CaMKIIdelta activation.
20494980 The PCP4 promoter is activated by Trichostatin A (TSA) treatment according to promoter reporter assays in HEK 293 cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
14551202 PEP-19 has the potential to alter the Ca2+-binding dynamics of free CaM and CaM that is bound to other target proteins

AA Sequence

MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS              1 - 62
//

Text Mined References (21)

PMID Year Title
25153723 2014 Anti-apoptotic effects of PCP4/PEP19 in human breast cancer cell lines: a novel oncotarget.
24954028 2014 Distribution of PCP4 protein in the forebrain of adult mice.
24403568 2014 PCP4: a regulator of aldosterone synthesis in human adrenocortical tissues.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
24291518 2014 Developmental molecular and functional cerebellar alterations induced by PCP4/PEP19 overexpression: implications for Down syndrome.
23204517 2013 The calmodulin regulator protein, PEP-19, sensitizes ATP-induced Ca2+ release.
21491429 2011 PCP4 (PEP19) overexpression induces premature neuronal differentiation associated with Ca(2+) /calmodulin-dependent kinase II-? activation in mouse models of Down syndrome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...