Property Summary

NCBI Gene PubMed Count 20
PubMed Score 83.93
PubTator Score 35.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Down syndrome -1.100 1.9e-02
adult high grade glioma -4.100 1.3e-07
aldosterone-producing adenoma 2.877 1.0e-02
Alzheimer's disease -1.200 1.6e-02
astrocytic glioma -2.300 1.1e-03
Astrocytoma, Pilocytic -3.700 8.1e-11
Atopic dermatitis -1.500 4.3e-03
atypical teratoid / rhabdoid tumor -1.900 3.8e-02
colon cancer -1.700 3.0e-02
cutaneous lupus erythematosus -2.200 4.5e-02
ependymoma -2.100 7.5e-04
esophageal adenocarcinoma -1.900 3.4e-02
glioblastoma -3.600 6.0e-08
group 3 medulloblastoma -2.700 2.1e-04
lung adenocarcinoma 1.300 9.1e-07
lung cancer 3.300 7.1e-06
lung carcinoma 2.100 1.3e-18
medulloblastoma, large-cell -4.800 9.4e-08
non-small cell lung cancer 1.422 1.3e-04
oligodendroglioma -1.900 9.4e-03
Pick disease -1.100 2.7e-03
primitive neuroectodermal tumor -2.200 2.3e-02
psoriasis -2.100 7.2e-05

Synonym

Accession P48539 A6NDJ9 Q6ICS4 Q93059
Symbols PEP-19

Gene

PDB

2N77  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS              1 - 62
//

Text Mined References (22)

PMID Year Title