Property Summary

NCBI Gene PubMed Count 122
PubMed Score 244.53
PubTator Score 204.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 6.9e-05
diabetes mellitus -1.600 3.6e-03
ependymoma 1.200 5.4e-08
glioblastoma 1.100 7.6e-04
lung carcinoma -1.400 6.7e-25
mucosa-associated lymphoid tissue lympho... 1.184 3.2e-02
ovarian cancer -1.600 1.1e-08
pediatric high grade glioma 1.600 2.2e-05
sonic hedgehog group medulloblastoma 1.100 6.3e-04
subependymal giant cell astrocytoma 1.620 5.3e-03

 GO Function (1)

 GWAS Trait (1)

Gene RIF (97)

AA Sequence

MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTV      1 - 70
VMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHE     71 - 140
AVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCIT    141 - 210
KLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY                               211 - 253
//

Text Mined References (127)

PMID Year Title