1. Home
  2. Targets
  3. cell adhesion molecule
  4. membrane-bound signaling molecule
  5. CD151 antigen

Tbio CD151 antigen

(Microbial infection) Plays a role in human papillomavirus 16/HPV-16 endocytosis upon binding to cell surface receptor.

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 107
PubMed Score 249.33
PubTator Score 204.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 6.6765630999969E-25
ovarian cancer 8492 1.11621010971842E-8
ependymoma 2514 5.35485896156189E-8
pediatric high grade glioma 2712 2.23499718598058E-5
pilocytic astrocytoma 3086 8.34966872108145E-5
glioblastoma 5572 4.1128467102613E-4
sonic hedgehog group medulloblastoma 1482 6.32611984964687E-4
diabetes mellitus 1663 0.00363301696551453
subependymal giant cell astrocytoma 2287 0.00531233981091074
mucosa-associated lymphoid tissue lymphoma 480 0.0323835719146515
Disease Target Count Z-score Confidence
Epidermolysis bullosa 21 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2346 3.806 1.9
Reticulate acropigmentation of Kitamura 9 3.513 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 1.500 0.000
ependymoma 1.200 0.000
diabetes mellitus -1.600 0.004
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.100 0.000
sonic hedgehog group medulloblastoma 1.100 0.001
subependymal giant cell astrocytoma 1.620 0.005
lung carcinoma -1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.184 0.032
ovarian cancer -1.600 0.000

Synonym

Accession P48509 A8KAK8 E9PI15 Q14826 Q86U54 Q96TE3
Symbols GP27
MER2
RAPH
SFA1
PETA-3
TSPAN24

Gene

CD151

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (1)

 GO Component (6)

 GO Process (5)

 Compartment GO Term (43)

See all...

 OMIM Term (2)

 MGI Term (10)

 HCA RNA Cell Line (56)

See all...

Pathway (9)

 UniProt Keyword (12)

See all...

Gene RIF (83)

PMID Text
26707073 CD151 knockdown inhibits the expression of MMP9 through the GSK-3b/bcatenin pathway and also inhibits Osteosarcoma (OS)migration and invasion in vitro and metastasis in vivo in highly metastatic OS.
26464707 In high grade DCIS, when stratified according to the HER2 status, in the HER2-negative subgroup, CD151 assessed in combination with alpha3beta1 was significantly correlated with prognosis.
26418968 the role of the CD151-alpha3beta1 complex in carcinoma progression is context dependent, and may depend on the mode of tumor cell invasion.
26377974 Data show that CD151 protein (CD151)-alpha3beta1 integrin complexes cooperated with epidermal growth factor receptor (EGFR) to drive tumor cell motility.
26245294 selective interaction with PY12 oligomers is crucial for platelet aggregation and thrombus stabilization
26136426 Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell Activation.
25356755 our study demonstrates that CD151-alpha3beta1 integrin complexes regulate ovarian tumor growth by repressing Slug-mediated epithelial to mesenchymal transition and Wnt signaling
25351816 Knockdown CD151 expression by targeted siRNA could inhibit the related downstream intercellular signaling pathways including FAK, PI3KAKT, MEKERK1/2MAPK as well as the expression of MMP9 and VEGF.
25275127 HIV-1 Nef downregulates the cell surface expression of CD151 (TSPAN24)
25119599 Increased expression of CD151 is associated with gastric cancer.
More...

AA Sequence 

MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTV      1 - 70
VMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHE     71 - 140
AVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCIT    141 - 210
KLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY                               211 - 253
//

Text Mined References (112)

PMID Year Title
26707073 2016 CD151 knockdown inhibits osteosarcoma metastasis through the GSK-3?/?-catenin/MMP9 pathway.
26464707 2015 Expression of CD151/Tspan24 and integrin alpha 3 complex in aid of prognostication of HER2-negative high-grade ductal carcinoma in situ.
26418968 2015 CD151 promotes ?3?1 integrin-dependent organization of carcinoma cell junctions and restrains collective cell invasion.
26377974 2015 CD151-?3?1 integrin complexes are prognostic markers of glioblastoma and cooperate with EGFR to drive tumor cell motility and invasion.
26245294 2015 A complementary role for tetraspanin superfamily member CD151 and ADP purinergic P2Y12 receptor in platelets.
26136426 2015 Tetraspanin CD151 Is a Negative Regulator of Fc?RI-Mediated Mast Cell Activation.
25416956 2014 A proteome-scale map of the human interactome network.
25356755 2014 CD151-?3?1 integrin complexes suppress ovarian tumor growth by repressing slug-mediated EMT and canonical Wnt signaling.
25351816 2015 Effects of tetraspanin CD151 inhibition on A549 human lung adenocarcinoma cells.
25241909 2014 Genetic susceptibility for chronic bronchitis in chronic obstructive pulmonary disease.
More...