Property Summary

NCBI Gene PubMed Count 69
Grant Count 81
R01 Count 45
Funding $6,049,463.14
PubMed Score 142.71
PubTator Score 79.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
gastric cancer 1.400 0.002
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.100 0.012
astrocytic glioma -1.200 0.029
psoriasis 2.500 0.000
osteosarcoma -3.370 0.000
posterior fossa group B ependymoma 1.400 0.000
group 4 medulloblastoma -1.600 0.001
medulloblastoma, large-cell -1.300 0.026
pancreatic ductal adenocarcinoma liver m... -1.612 0.006
tuberculosis and treatment for 3 months -1.200 0.002
non-small cell lung cancer 1.342 0.000
lung cancer 2.100 0.001
colon cancer 1.100 0.034
cystic fibrosis -1.200 0.008
pancreatic carcinoma 1.100 0.012
aldosterone-producing adenoma -1.076 0.024
nasopharyngeal carcinoma -1.200 0.000
ovarian cancer 2.000 0.000

Synonym

Accession P48507 A8K334 D3DT45 M5A959 Q6FHC1 Q9NPX9 Q9NU74
Symbols GLCLR

Gene

PANTHER Protein Class (1)

Gene RIF (57)

PMID Text
26507778 Data suggest gene expression in vascular endothelium is altered by dietary factors; aged garlic extract induces expression of HMOX1 (heme oxygenase-1) and GCLM via activation of NRF2-ARE (nuclear factor erythroid 2-antioxidant response element) signaling.
26365678 Data suggest expression of hepatocyte GCLC and GCLM can be regulated by dietary component; alpha-lipoic acid, a vitamin B complex nutrient, protects against oxidative stress/cytotoxicity induced by cadmium via restoration of GCLC and GCLM expression.
26220190 This study demonstrated that Tuberous sclerosis complex neuropathology requires glutamate-cysteine ligase.
25789740 Knockdown of glutamate cysteine ligase catalytic subunit by siRNA causes the gold nanoparticles-induced cytotoxicity in lung cancer cells.
25353619 miR-433 targets both catalytic (GCLc) and regulatory (GCLm) subunits of GCL.
24786516 miR-320a has a role in modulating the induction of HO-1, GCLM and OKL38 by oxidized phospholipids in endothelial cells
24557597 Upregulation of both GCLC and GLCM mRNA levels in response to cysteine deprivation was dependent on new protein synthesis.
24535845 Ten of the 17 maternal SNPs and 2 of the 17 fetal SNPs were found within the GCLM gene conotruncal heart defect cases.
23743623 TP is expressed at high levels in human GBM tumors and shRNA knockdown of TP in U87 GBM cells results in a significant increase in cellular GCL enzymatic activity
21555518 GCLM is a functional target gene of the BACH1 transcription factor according to ChIP-seq and knockdown analysis in HEK 293 cells.
More...

AA Sequence

MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVL      1 - 70
ECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSL     71 - 140
EHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQ    141 - 210
LLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS          211 - 274
//

Text Mined References (72)

PMID Year Title
26507778 2016 Aged garlic extract enhances heme oxygenase-1 and glutamate-cysteine ligase modifier subunit expression via the nuclear factor erythroid 2-related factor 2-antioxidant response element signaling pathway in human endothelial cells.
26365678 2015 ?-Lipoic acid protects against the oxidative stress and cytotoxicity induced by cadmium in HepG2 cells through regenerating glutathione regulated by glutamate-cysteine ligase.
26220190 2015 Tuberous sclerosis complex neuropathology requires glutamate-cysteine ligase.
25789740 2015 Knockdown of glutamate cysteine ligase catalytic subunit by siRNA causes the gold nanoparticles-induced cytotoxicity in lung cancer cells.
25353619 2015 Targeting of Gamma-Glutamyl-Cysteine Ligase by miR-433 Reduces Glutathione Biosynthesis and Promotes TGF-?-Dependent Fibrogenesis.
24786516 2014 MicroRNA miR-320a modulates induction of HO-1, GCLM and OKL38 by oxidized phospholipids in endothelial cells.
24557597 2014 Upregulation of capacity for glutathione synthesis in response to amino acid deprivation: regulation of glutamate-cysteine ligase subunits.
24535845 2014 Conotruncal heart defects and common variants in maternal and fetal genes in folate, homocysteine, and transsulfuration pathways.
23743623 2013 Glycation of glutamate cysteine ligase by 2-deoxy-d-ribose and its potential impact on chemoresistance in glioblastoma.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
More...