Property Summary

NCBI Gene PubMed Count 72
PubMed Score 156.27
PubTator Score 79.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
aldosterone-producing adenoma -1.055 4.4e-02
astrocytic glioma -1.200 2.9e-02
colon cancer 1.100 3.4e-02
cystic fibrosis -1.200 7.9e-03
ependymoma 1.100 1.5e-07
gastric cancer 1.400 1.9e-03
group 4 medulloblastoma -1.600 5.7e-04
hepatocellular carcinoma 1.200 5.8e-05
lung cancer 2.100 8.0e-04
medulloblastoma, large-cell -1.300 2.6e-02
nasopharyngeal carcinoma -1.200 6.1e-05
non-small cell lung cancer 1.342 4.2e-08
osteosarcoma -3.370 1.3e-05
ovarian cancer 2.000 3.8e-04
pancreatic cancer 1.100 1.2e-02
pancreatic carcinoma 1.100 1.2e-02
pancreatic ductal adenocarcinoma liver m... -1.417 9.0e-03
psoriasis 2.500 4.6e-05
tuberculosis -1.100 7.8e-04

Synonym

Accession P48507 A8K334 D3DT45 M5A959 Q6FHC1 Q9NPX9 Q9NU74
Symbols GLCLR

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (59)

AA Sequence

MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVL      1 - 70
ECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSL     71 - 140
EHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQ    141 - 210
LLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS          211 - 274
//

Text Mined References (75)

PMID Year Title