Property Summary

NCBI Gene PubMed Count 38
PubMed Score 22.60
PubTator Score 23.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis -1.245 2.0e-02
group 4 medulloblastoma -1.100 4.6e-04
lung adenocarcinoma -1.200 1.9e-10
lung cancer -1.200 1.3e-03
malignant mesothelioma -2.100 3.7e-07
medulloblastoma, large-cell -1.600 1.5e-03
non primary Sjogren syndrome sicca 1.100 2.3e-02
osteosarcoma -2.188 1.5e-05
ovarian cancer -1.100 1.5e-08
psoriasis -1.800 2.4e-04

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (31)

AA Sequence

MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQ      1 - 70
EKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTL     71 - 140
FLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDCLPLAALLNQQFLCVHGGMSPEITSLDDIRK    141 - 210
LDRFTEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQ    211 - 280
DAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSL    281 - 350
PFVGEKVTEMLVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL    351 - 420
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPM    421 - 490
KSVTSAHSHAAHRSDQGKKAHS                                                    491 - 512
//

Text Mined References (41)

PMID Year Title