Property Summary

NCBI Gene PubMed Count 37
Grant Count 8
R01 Count 8
Funding $665,047.58
PubMed Score 20.99
PubTator Score 23.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
psoriasis -1.800 0.000
osteosarcoma -2.646 0.000
medulloblastoma -1.300 0.001
medulloblastoma, large-cell -1.900 0.001
lung cancer -1.300 0.001
active ulcerative colitis -1.245 0.020
non primary Sjogren syndrome sicca 1.100 0.023
lung adenocarcinoma -1.200 0.000
ovarian cancer -1.100 0.000

Gene RIF (30)

PMID Text
26627835 Knockdown of CNAgamma leads to a disruption of synaptic vesicle cycling in hippocampal neurons.
24709691 The PPP3CC involved in the regulation of immune system and synaptic plasticity, seems promising for further investigation.
24086760 HIV-1 gp120-induced dephosphorylation of KV2.1 is dependent on NMDA receptor-mediated activation of protein phosphatase 2B or calcineurin
23747857 protein level of PPP3CC negatively correlates with the cellular level of IP3, suggesting a regulatory role of PPP3CC in the IP3-Ca2+ signaling pathway
23497497 study suggests that NMDA receptor-mediated signalling genes, DAO, PPP3CC, DTNBP1 might be involved in schizophrenia pathogenic mechanisms related to gender
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21047202 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20593291 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20537399 This study demoistrated that PPP3CC are not genetic risk factors for schizophrenia in japanese.
20537399 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQ      1 - 70
EKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTL     71 - 140
FLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDCLPLAALLNQQFLCVHGGMSPEITSLDDIRK    141 - 210
LDRFTEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQ    211 - 280
DAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSL    281 - 350
PFVGEKVTEMLVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL    351 - 420
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPM    421 - 490
KSVTSAHSHAAHRSDQGKKAHS                                                    491 - 512
//

Text Mined References (40)

PMID Year Title
26627835 2016 Calcineurin A? is a Functional Phosphatase That Modulates Synaptic Vesicle Endocytosis.
25416956 2014 A proteome-scale map of the human interactome network.
24709691 2014 PPP3CC gene: a putative modulator of antidepressant response through the B-cell receptor signaling pathway.
23747857 2013 PPP3CC feedback regulates IP3-Ca2+ pathway through preventing ITPKC degradation.
23497497 2013 Schizophrenia susceptibility and NMDA-receptor mediated signalling: an association study involving 32 tagSNPs of DAO, DAOA, PPP3CC, and DTNBP1 genes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21047202 2010 Using genetic and clinical factors to predict tacrolimus dose in renal transplant recipients.
20593291 2010 Polymorphisms in the calcineurin genes are associated with the training responsiveness of cardiac phenotypes in Chinese young adults.
More...