Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.77
PubTator Score 1.50

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.36956119802147E-13
psoriasis 6685 2.16491453730399E-7
nasopharyngeal carcinoma 1056 4.88527411703124E-5
cystic fibrosis 1670 4.68142069018885E-4
interstitial cystitis 2299 4.90405709585288E-4
ductal carcinoma in situ 1745 8.36646185411179E-4
ovarian cancer 8492 0.00221787079184844
invasive ductal carcinoma 2950 0.0166532421531845
esophageal adenocarcinoma 737 0.0180659511873377


  Differential Expression (9)

Disease log2 FC p
esophageal adenocarcinoma -2.900 0.018
psoriasis 2.400 0.000
non-small cell lung cancer 2.168 0.000
interstitial cystitis -1.800 0.000
cystic fibrosis 1.300 0.000
nasopharyngeal carcinoma -1.300 0.000
ductal carcinoma in situ 3.400 0.001
invasive ductal carcinoma 2.600 0.017
ovarian cancer 1.500 0.002


Accession P48448 Q53Y98 Q8NAL5 Q96IB2
Symbols ALDH8


PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
S.cerevisiae OMA Inparanoid

Gene RIF (2)

20237496 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

PSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL                                       351 - 385

Text Mined References (12)

PMID Year Title
25286108 2015 Mouse aldehyde dehydrogenase ALDH3B2 is localized to lipid droplets via two C-terminal tryptophan residues and lipid modification.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9161417 1997 Human aldehyde dehydrogenase genes, ALDH7 and ALDH8: genomic organization and gene structure comparison.