Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.80
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cystic fibrosis 1.300 4.7e-04
ductal carcinoma in situ 3.400 8.4e-04
esophageal adenocarcinoma -1.900 1.9e-02
interstitial cystitis -1.200 4.1e-02
invasive ductal carcinoma 2.600 1.7e-02
nasopharyngeal carcinoma -1.300 4.9e-05
non-small cell lung cancer 2.168 1.4e-13
ovarian cancer 1.500 2.2e-03
psoriasis 2.200 5.1e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLA      1 - 70
EVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDD     71 - 140
NCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGHIINQKQF    141 - 210
QRLRALLGCSRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINRQEKP    211 - 280
LALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLA    281 - 350
PSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL                                       351 - 385
//

Text Mined References (14)

PMID Year Title