Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
R01 Count 4
Funding $526,750
PubMed Score 6.13
PubTator Score 10.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.183 0.001
acute quadriplegic myopathy 1.052 0.000
Breast cancer 3.000 0.026
ovarian cancer 2.600 0.000
dermatomyositis 1.300 0.000

Synonym

Accession P48444 B4E1X2 E9PEU4 Q52M80
Symbols COPD
SRMMD

Gene

 GO Function (1)

Gene RIF (3)

PMID Text
26498766 The authors demonstrated that miR-33a could impede influenza A virus replication at the stage of virus internalization by suppressing ARCN1 expression.
23300798 Single nucleotide polymorphisms in the PHLDB1 and ARCN1 genes are associated with increased risk of Glioma.
22750876 native crystals of delta-COP had unit-cell parameters a = 100.23, b = 136.77, c = 44.39 A

AA Sequence

MVLLAAAVCTKAGKAIVSRQFVEMTRTRIEGLLAAFPKLMNTGKQHTFVETESVRYVYQPMEKLYMVLIT      1 - 70
TKNSNILEDLETLRLFSRVIPEYCRALEENEISEHCFDLIFAFDEIVALGYRENVNLAQIRTFTEMDSHE     71 - 140
EKVFRAVRETQEREAKAEMRRKAKELQQARRDAERQGKKAPGFGGFGSSAVSGGSTAAMITETIIETDKP    141 - 210
KVAPAPARPSGPSKALKLGAKGKEVDNFVDKLKSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEE    211 - 280
KITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPE    281 - 350
KSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAP    351 - 420
VIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVD    421 - 490
GNSPVRFSTETTFLVDKYEIL                                                     491 - 511
//

Text Mined References (28)

PMID Year Title
26498766 2016 MicroRNA-33a disturbs influenza A virus replication by targeting ARCN1 and inhibiting viral ribonucleoprotein activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23300798 2012 Fine mapping of a region of chromosome 11q23.3 reveals independent locus associated with risk of glioma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22750876 2012 Crystallization and preliminary X-ray analysis of the C-terminal domain of ?-COP, a medium-sized subunit of the COPI complex involved in membrane trafficking.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...