Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.38
PubTator Score 10.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Ataxia 15 0.0 0.0
Disease Target Count P-value
acute quadriplegic myopathy 1158 5.8e-06
dermatomyositis 966 2.9e-04
ovarian cancer 8520 5.2e-04
Multiple myeloma 1332 8.0e-04
Breast cancer 3578 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.052 5.8e-06
Breast cancer 3.000 2.6e-02
dermatomyositis 1.300 2.9e-04
Multiple myeloma 1.183 8.0e-04
ovarian cancer -1.100 5.2e-04

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MVLLAAAVCTKAGKAIVSRQFVEMTRTRIEGLLAAFPKLMNTGKQHTFVETESVRYVYQPMEKLYMVLIT      1 - 70
TKNSNILEDLETLRLFSRVIPEYCRALEENEISEHCFDLIFAFDEIVALGYRENVNLAQIRTFTEMDSHE     71 - 140
EKVFRAVRETQEREAKAEMRRKAKELQQARRDAERQGKKAPGFGGFGSSAVSGGSTAAMITETIIETDKP    141 - 210
KVAPAPARPSGPSKALKLGAKGKEVDNFVDKLKSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEE    211 - 280
KITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPE    281 - 350
KSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAP    351 - 420
VIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVD    421 - 490
GNSPVRFSTETTFLVDKYEIL                                                     491 - 511
//

Text Mined References (29)

PMID Year Title