Property Summary

NCBI Gene PubMed Count 70
Grant Count 9
R01 Count 3
Funding $324,502.83
PubMed Score 40.43
PubTator Score 30.65

Knowledge Summary

Patent (4,873)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.300 0.000
non diabetic and post-ischemic heart fai... 1.100 0.008
medulloblastoma, large-cell 1.400 0.003
group 4 medulloblastoma 1.100 0.040
lung carcinoma 1.300 0.000
dermatomyositis -1.200 0.012

Synonym

Accession P48443 A6NIP1 Q6IBU7
Symbols RXRC
NR2B3

Gene

PDB

2GL8  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

Gene RIF (29)

PMID Text
26355550 Data show that pregnane X receptor/retinoid X receptor PXR/RXR-[alpha], RXR-[beta], or RXR-[gamma] expression was noted in 9 (16.4%), 9 (16.4%), and 10 (18.2%) pancreatic adenocarcinoma cases, respectively.
26148973 Data show that some rexinoids display selective coactivator (CoA) recruitment by the retinoid X receptors (RXRs) homodimer and by the heterodimers nuclear receptor Nur77/RXR and Nurr1/RXR.
23969901 Differences in RAR and RXR subtype mRNA expression patterns in various PTCs may contribute to the immunochemistry data available, and may thus find exploitation in clinical oncology, particularly in the differential diagnosis of thyroid neoplasms.
23936423 loss of RXR-gamma levels appears to provide mechanistic benefits to transformed cells towards the acquisition of resistance to apoptosis hallmark of cancer
23759678 Genetic variation in RXRgamma gene may contribute to the development of HIVLD in combination antiretroviral therapy treated HIV patients.
22180072 The RXR-gamma rs3818569 single nucleotide polymorphisms is associated with diabetic retinopathy development in the Taiwanese population.
21923909 HIV-1 Nef induces loss of F-actin assembly and inhibits retinoid receptor-mediated transcription
21131950 results indicate that RXR-gamma is a positive regulator of endogenous oligodendrocyte precursor cell differentiation and remyelination.
20855565 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPY      1 - 70
RVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICA     71 - 140
ICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQ    141 - 210
EERQRSRERAESEAECATSGHEDMPVERILEAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTL    211 - 280
VEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRV    281 - 350
LTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL    351 - 420
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT                               421 - 463
//

Text Mined References (70)

PMID Year Title
26355550 2015 Pregnane X Receptor Expression in Human Pancreatic Adenocarcinoma: Associations With Clinicopathologic Parameters, Tumor Proliferative Capacity, Patients' Survival, and Retinoid X Receptor Expression.
26148973 2015 Selective ligand activity at Nur/retinoid X receptor complexes revealed by dimer-specific bioluminescence resonance energy transfer-based sensors.
25416956 2014 A proteome-scale map of the human interactome network.
25303530 2014 Enhancer activation requires trans-recruitment of a mega transcription factor complex.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
23969901 2013 mRNA expression pattern of retinoic acid and retinoid X nuclear receptor subtypes in human thyroid papillary carcinoma.
23936423 2013 Expression proteomics predicts loss of RXR-? during progression of epithelial ovarian cancer.
23759678 2013 RXR? gene variants are associated with HIV lipodystrophy.
22193333 2012 Adaptive evolution of the Retinoid X receptor in vertebrates.
22180072 2011 Association between retinoid-X receptor-gamma genetic polymorphisms and diabetic retinopathy.
More...