Property Summary

NCBI Gene PubMed Count 257
Grant Count 412
R01 Count 243
Funding $33,804,440.95
PubMed Score 1202.55
PubTator Score 839.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (55)

Disease Z-score Confidence
Campomelic dysplasia 7 7.604 3.8
Osteoarthritis 96 5.489 2.7
Degenerative disc disease 28 4.924 2.5
Hypogonadism 70 4.467 2.2
Cancer 2,346 4.287 2.1
Hypospadias 65 3.742 1.9
Gonadoblastoma 27 3.644 1.8
Cleft palate 125 3.406 1.7
Fibrochondrogenesis 8 3.381 1.7
46 XY gonadal dysgenesis 9 5.0
46, XX Testicular Disorders of Sex Devel... 3 
46,XX SEX REVERSAL 2 1
ANONYCHIA 2
Acampomelic Campomelic Dysplasia 1
Alzheimer's disease 644
Animal Mammary Neoplasms 136
Breast cancer 3,094
CAMPOMELIC DYSPLASIA WITH AUTOSOMAL SEX ... 1 
Child Development Disorders, Pervasive 55
Congenital Hand Deformities 8
Craniofacial Abnormalities 147
Down syndrome 548
Mammary Neoplasms, Experimental 150
Osteoporosis 257 2.0
Ovotesticular Disorders of Sex Developme... 2 
Pick disease 1,893
Pierre Robin Syndrome 1
Swyer Syndrome 8
X-linked cerebral adrenoleukodystrophy 115
XX males 3
astrocytoma 1,493
colon cancer 1,475
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
ependymoma 2,514
esophageal adenocarcinoma 737
glioblastoma 5,572
group 4 medulloblastoma 1,875
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
lung adenocarcinoma 2,713
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
nephrosclerosis 329
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pituitary cancer 1,972
primitive neuroectodermal tumor 3,031
psoriasis 6,685

Expression

Synonym

Accession P48436 Q53Y80
Symbols CMD1
SRA1
CMPD1
SRXX2
SRXY10

Gene

PDB

1S9M   1SX9   4EUW  

Gene RIF (216)

PMID Text
26830674 Overexpression of TGF-beta and sox9 enhanced the levels of cell proliferation, matrix biosynthesis, and chondrogenic differentiation in human mesenchymal stem cells.
26663529 Variability has been found in a three-generation family with Pierre Robin sequence, acampomelic campomelic dysplasia, and intellectual disability due to a novel approximately 1 Mb deletion upstream of SOX9, and including KCNJ2 and KCNJ16.
26634652 Aortic valve endothelial cell derived Tgfb1 signaling promotes nuclear localization of Sox9 in interstitial cells, attenuating aortic valve calcification.
26617720 SOX9 expression was commonly upregulated in glioma tissues, and patients with high SOX9 levels had shorter survival times.
26467042 Our study shows an inversed preferential nuclear expression of SLUG, SOX10, and SOX9 in triple negative and non-triple negative cases.
26455392 EGFR mutations remodel the activated enhancer landscape of glioblastoma multiforme, promoting tumorigenesis through a SOX9 and FOXG1-dependent transcriptional regulatory network in vitro and in vivo.
26384302 Upregulation of sex-determining region Y-box 9 promotes cell proliferation and tumorigenicity in esophageal squamous cell carcinoma.
26341967 Sox9 overexpression in intrahepatic cholangiocarcinoma is related to biliary infiltration and poorer prognosis, and it promotes cell migration and invasion, via the epithelial-to-mesenchymal transition.
26317788 MicroRNA-494 inhibits cell proliferation and invasion of chondrosarcoma cells in vivo and in vitro by down-regulating SOX9 expression.
26162802 SOX9 upregulation might mediate A disintegrin and metalloproteinase with thrombospondin motifs (ADAMTSs) suppression at the early stage of human osteoarthritis. In addition, SOX9 could be used as a potential therapeutic agent for human osteoarthritis at an early stage.
More...

AA Sequence

MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFP      1 - 70
VCIREAVSQVLKGYDWTLVPMPVRVNGSSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLG     71 - 140
KLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSVKNGQAEAEEATEQTHISPNAIFKALQAD    141 - 210
SPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSS    211 - 280
DVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPP    281 - 350
QAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAY    351 - 420
SPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIP    421 - 490
QTHSPQHWEQPVYTQLTRP                                                       491 - 509
//

Text Mined References (258)

PMID Year Title
26830674 2016 Co-overexpression of TGF-? and SOX9 via rAAV gene transfer modulates the metabolic and chondrogenic activities of human bone marrow-derived mesenchymal stem cells.
26687115 2016 The microRNA-29 family in cartilage homeostasis and osteoarthritis.
26663529 2016 Variability in a three-generation family with Pierre Robin sequence, acampomelic campomelic dysplasia, and intellectual disability due to a novel ?1 Mb deletion upstream of SOX9, and including KCNJ2 and KCNJ16.
26634652 2016 Valve Endothelial Cell-Derived Tgf?1 Signaling Promotes Nuclear Localization of Sox9 in Interstitial Cells Associated With Attenuated Calcification.
26617720 2015 Decreased expression of SOX9 indicates a better prognosis and inhibits the growth of glioma cells by inducing cell cycle arrest.
26467042 2015 Differential expression of epithelial–mesenchymal transition and stem cell markers in intrinsic subtypes of breast cancer.
26455392 2015 EGFR Mutation Promotes Glioblastoma through Epigenome and Transcription Factor Network Remodeling.
26384302 2015 Upregulation of sex-determining region Y-box 9 (SOX9) promotes cell proliferation and tumorigenicity in esophageal squamous cell carcinoma.
26341967 2015 Sox9 expression in carcinogenesis and its clinical significance in intrahepatic cholangiocarcinoma.
26317788 2015 MicroRNA-494 inhibits cell proliferation and invasion of chondrosarcoma cells in vivo and in vitro by directly targeting SOX9.
More...