Property Summary

NCBI Gene PubMed Count 374
Grant Count 514
R01 Count 245
Funding $56,581,462.9
PubMed Score 1399.87
PubTator Score 1016.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P48431 Q14537
Symbols ANOP3
MCOPS3

Gene

PDB

1O4X   2LE4  

Gene RIF (352)

PMID Text
26992828 Sox2 and Oct4 function as molecular rheostats and utilize negative feedback loops to carefully balance their expression and other critical genes during embryogenesis. (Review)
26969300 Results demonstrate that SOX2 played a central role in promoting Ewing's sarcoma cell proliferation suggesting that it may serve as a potential biomarker.
26945967 Activated eIF4E, which is phosphorylated by MNK1, is a regulator of Sox2 expression after irradiation of pancreatic tumor cells.
26809499 SOX2 ensures pluripotent epigenetic landscapes via interacting with histone.
26780934 This prompts for further studies on the mechanisms behind the TP53-induced regulation of SOX2 expression and the possible importance of hsa-miR-145 in lung cancer.
26743476 Suggest that NKX6.3 might function as a master regulator of gastric differentiation by affecting SOX2 and CDX2 expression and the NKX6.3 inactivation may result in intestinal metaplasia in gastric epithelial cells.
26706028 OCT4 overexpression and loss of SOX2 expression are strongly associated with poor prognosis in patients with cervical cancer.
26703382 Both Sox2ot-7 and Sox2ot-8 are highly expressed in human cancer cell lines coinciding with SOX2, one of the pluripotency regulators.
26677051 SOX2 mRNA binds to and is regulated by HuR in mesenchymal stem cells.
26654770 Several novel and known AKT phosphorylation sites are identified within OCT4, SOX2 and KLF4.
More...

AA Sequence

MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSE      1 - 70
ISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA     71 - 140
SGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSM    141 - 210
TSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG    211 - 280
AEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM                                     281 - 317
//

Text Mined References (374)

PMID Year Title
26992828 2016 Sox2/Oct4: A delicately balanced partnership in pluripotent stem cells and embryogenesis.
26969300 2016 Inhibition of SOX2 induces cell apoptosis and G1/S arrest in Ewing's sarcoma through the PI3K/Akt pathway.
26945967 2016 eIF4E-phosphorylation-mediated Sox2 upregulation promotes pancreatic tumor cell repopulation after irradiation.
26809499 2016 Comprehensive profiling reveals mechanisms of SOX2-mediated cell fate specification in human ESCs and NPCs.
26780934 2016 Mutations in TP53 increase the risk of SOX2 copy number alterations and silencing of TP53 reduces SOX2 expression in non-small cell lung cancer.
26743476 2016 Inactivation of NKX6.3 in the stomach leads to abnormal expression of CDX2 and SOX2 required for gastric-to-intestinal transdifferentiation.
26706028 2015 Clinical significance of OCT4 and SOX2 protein expression in cervical cancer.
26703382 2016 Identification of new SOX2OT transcript variants highly expressed in human cancer cell lines and down regulated in stem cell differentiation.
26677051 2016 Human Antigen R Binding and Regulation of SOX2 mRNA in Human Mesenchymal Stem Cells.
26654770 2015 Novel AKT phosphorylation sites identified in the pluripotency factors OCT4, SOX2 and KLF4.
More...