Property Summary

NCBI Gene PubMed Count 458
PubMed Score 1563.03
PubTator Score 1016.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Esophageal atresia 43
Abnormal vision 52
Abnormally small eyeball 97
Absence of rib 7
Accessory rib 10
Adenocarcinoma of lung (disorder) 60
Agenesis of corpus callosum 83
Anterior pituitary hypoplasia 13
Butterfly vertebrae 7
Cleft Palate 271
Cognitive delay 608
Congenital deafness 185
Congenital hemivertebra 25
Congenital hypoplasia of penis 176
Congenital ocular coloboma (disorder) 40
Cryptorchidism 296
Deafness 198
Decreased size of eyeball 97
Epilepsy 792
Frontal bossing 157
Fused vertebrae 25
Global developmental delay 608
Hearing Loss, Partial 185
Hemiplegia and hemiparesis 38
Hypogonadism, Isolated Hypogonadotropic 71
Hypogonadotropic hypogonadism 89
Hypoplasia of corpus callosum 90
Hypoplasia of spine 2
Hypoplasia of the optic nerve 17
Hypothalamic hamartomas 4
Little's Disease 14
Low Vision 174
MICROPHTHALMIA, ISOLATED 1 7
Mental and motor retardation 608
Microphthalmos 100
Muscle hypotonia 571
Nystagmus 317
Patent ductus arteriosus 90
Penile hypospadias 106
Pituitary hypoplasia 23
Postnatal growth retardation 57
Rib fusion 16
Seizures 596
Sensorineural Hearing Loss (disorder) 284
Septo-Optic Dysplasia 11
Short stature 531
Small cell carcinoma of lung 45
Small head 374
Spastic Quadriplegia 42
Specific learning disability 47
Spinal fusion 25
Squamous cell carcinoma 129
Squamous cell carcinoma of esophagus 77
Strabismus 270
Tracheoesophageal Fistula 36
Uranostaphyloschisis 167
Ventricular Septal Defects 119
Vertebral body fusion 25
Visual Impairment 174
hearing impairment 199
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Panhypopituitarism 14 0.0 5.0
Disease Target Count Z-score Confidence
Microphthalmia 76 4.772 2.4

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.200 1.5e-02
atypical teratoid / rhabdoid tumor 1.100 2.9e-05
cystic fibrosis 1.200 2.6e-02
ependymoma 2.300 4.4e-02
esophageal adenocarcinoma -1.100 2.5e-02
glioblastoma 1.100 9.1e-09
group 3 medulloblastoma -2.700 5.1e-05
intraductal papillary-mucinous carcinoma... 2.100 4.0e-02
lung cancer 1.900 8.6e-04
lung carcinoma 1.600 9.0e-05
medulloblastoma, large-cell -2.700 1.0e-03
non-small cell lung cancer 3.538 8.4e-14
oligodendroglioma 2.500 1.8e-02
pediatric high grade glioma 1.300 3.5e-03
pituitary cancer -1.600 2.5e-04
primitive neuroectodermal tumor 1.500 1.7e-02
subependymal giant cell astrocytoma 1.108 2.0e-02

Gene RIF (435)

AA Sequence

MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSE      1 - 70
ISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA     71 - 140
SGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSM    141 - 210
TSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG    211 - 280
AEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM                                     281 - 317
//

Text Mined References (458)

PMID Year Title