Property Summary

NCBI Gene PubMed Count 46
Grant Count 36
R01 Count 30
Funding $2,446,089.12
PubMed Score 53.39
PubTator Score 42.11

Knowledge Summary

Patent (1,480)

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -2.579 0.000
posterior fossa group B ependymoma -1.900 0.000
glioblastoma -1.100 0.001
atypical teratoid/rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -1.100 0.003
primitive neuroectodermal tumor -1.200 0.000
diabetes mellitus -1.200 0.037
pediatric high grade glioma -1.300 0.000
sonic hedgehog group medulloblastoma -1.400 0.001
primary Sjogren syndrome 1.500 0.015
lung carcinoma -1.400 0.000
gastric carcinoma 1.100 0.023
ulcerative colitis 1.200 0.000
ovarian cancer -1.600 0.000

Gene RIF (36)

PMID Text
25548108 PIP5K2A is possibly involved in a mechanism protecting against tardive dyskinesia-inducing neurotoxicity.
25025909 The diplotype ATTGCT/ATTGCT of the PIP4K2A gene confers approximately three-times higher incomplete responsiveness towards antipsychotics in severely ill patients.
24788727 We also showed that PIPKIIalpha silencing can induce alpha and gamma globin expression and decrease cell proliferation in K562 cells.
24681948 PIP4K2A to be essential for the clonogenic and leukemia-initiating potential of human AML cells, and for the clonogenic potential of murine MLL-AF9 AML cells.
24209622 Knocking down PI5P4Kalpha and beta in a breast cancer cell line bearing an amplification of the gene encoding PI5P4K beta and deficient for p53 impaired growth on plastic and in xenografts.
24086693 Overexpression of type 2A PI(4)P5-kinase (PIP5K 2A) significantly reduced tamoxifen inhibition of Kv7.2/Kv7.3 and Kv7.2 R463Q channels.
24081551 The data suggest that PI5P4Ka N251S does not significantly differ in activity from the wild-type enzyme, throwing a new light on its association with schizophrenia.
23996088 Variation at 10p12.2 (PIP4K2A) and 10p14 (GATA3) influences risk of acute lymphoblastic anemia and tumor subtype. (Meta-analysis)
23739505 PIP5K2A variant influences susceptibility to schizophrenia in the Russian population of Siberia. Authors studied 355 patients with schizophrenic disorders from the Russian population of Siberia.
21377334 The present study demonstrated that expression of PIP4K2A mRNA is significantly increased in LCL derived from patients with schizophrenia
More...

AA Sequence

MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVMLMPDDFKAYS      1 - 70
KIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDK     71 - 140
RYIIKTITSEDVAEMHNILKKYHQYIVECHGITLLPQFLGMYRLNVDGVEIYVIVTRNVFSHRLSVYRKY    141 - 210
DLKGSTVAREASDKEKAKELPTLKDNDFINEGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGI    211 - 280
HDVERAEQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRK    281 - 350
EVYFMAIIDILTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILT                  351 - 406
//

Text Mined References (55)

PMID Year Title
25578879 2015 PI(5)P regulates autophagosome biogenesis.
25548108 2014 Association study indicates a protective role of phosphatidylinositol-4-phosphate-5-kinase against tardive dyskinesia.
25495341 2015 The function of phosphatidylinositol 5-phosphate 4-kinase ? (PI5P4K?) explored using a specific inhibitor that targets the PI5P-binding site.
25025909 2014 Genetic variations of PIP4K2A confer vulnerability to poor antipsychotic response in severely ill schizophrenia patients.
24788727 2014 PIPKII? is widely expressed in hematopoietic-derived cells and may play a role in the expression of alpha- and gamma-globins in K562 cells.
24681948 2015 A targeted knockdown screen of genes coding for phosphoinositide modulators identifies PIP4K2A as required for acute myeloid leukemia cell proliferation and survival.
24209622 2013 Depletion of a putatively druggable class of phosphatidylinositol kinases inhibits growth of p53-null tumors.
24086693 2013 Tamoxifen inhibition of kv7.2/kv7.3 channels.
24081551 2013 Enzyme activity of the PIP4K2A gene product polymorphism that is implicated in schizophrenia.
23996088 2013 Variation at 10p12.2 and 10p14 influences risk of childhood B-cell acute lymphoblastic leukemia and phenotype.
More...