Property Summary

NCBI Gene PubMed Count 48
PubMed Score 57.39
PubTator Score 42.11

Knowledge Summary

Patent (1,480)

TINX Plot

  Disease (6)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.300 1.3e-02
atypical teratoid / rhabdoid tumor -1.800 4.3e-08
diabetes mellitus -1.200 3.7e-02
ependymoma -1.800 5.4e-10
gastric carcinoma 1.100 2.3e-02
glioblastoma -1.100 1.1e-03
group 4 medulloblastoma -1.100 9.9e-03
lung carcinoma -1.400 1.1e-25
medulloblastoma, large-cell -1.100 2.9e-03
osteosarcoma -2.106 1.8e-02
ovarian cancer -1.600 1.3e-08
primary Sjogren syndrome 1.500 1.5e-02
primitive neuroectodermal tumor -1.200 3.9e-04
ulcerative colitis 1.200 1.1e-04

Gene RIF (38)

AA Sequence

MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVMLMPDDFKAYS      1 - 70
KIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDK     71 - 140
RYIIKTITSEDVAEMHNILKKYHQYIVECHGITLLPQFLGMYRLNVDGVEIYVIVTRNVFSHRLSVYRKY    141 - 210
DLKGSTVAREASDKEKAKELPTLKDNDFINEGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGI    211 - 280
HDVERAEQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRK    281 - 350
EVYFMAIIDILTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILT                  351 - 406
//

Text Mined References (57)

PMID Year Title