Property Summary

NCBI Gene PubMed Count 31
PubMed Score 34.54
PubTator Score 36.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Bare lymphocyte syndrome 2 4 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
MHC class II deficiency 6 0.0 5.0
Disease Target Count Z-score Confidence
Severe combined immunodeficiency 51 5.161 2.6
Disease Target Count Z-score Confidence
3-M syndrome 15 3.332 1.7
Disease Target Count
Bare Lymphocyte Syndrome, Type 2 4

Expression

  Differential Expression (16)

Disease log2 FC p
Breast cancer 1.200 4.9e-18
breast carcinoma 1.200 4.1e-06
colon cancer 1.300 1.2e-02
cutaneous lupus erythematosus 1.700 5.1e-04
dermatomyositis 1.100 1.7e-03
intraductal papillary-mucinous adenoma (... 1.200 2.2e-02
intraductal papillary-mucinous carcinoma... 1.300 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.700 1.7e-02
lung cancer 1.500 2.5e-02
Multiple myeloma 1.625 1.3e-04
osteosarcoma -2.035 1.7e-06
ovarian cancer 1.700 6.0e-05
pancreatic ductal adenocarcinoma liver m... 1.102 2.5e-02
primary Sjogren syndrome 1.200 1.3e-02
psoriasis -1.300 2.5e-04
ulcerative colitis 1.100 1.0e-06

Protein-protein Interaction (5)

Gene RIF (13)

AA Sequence

MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLPS      1 - 70
GPTTGDKSSEPSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIR     71 - 140
EIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDLKGSESPEMGPEVTPAPRDELVEAACALTCD    141 - 210
WAERILKRSFSSIVEVARFLLQQHLISARSAHAHVLKAMGLAEEDEHAPRERSSKPKNGLENPEGGAHKK    211 - 280
PERLAQPPKDLEARTGAGPLARGERKKSVVESSAPGANNLQVNALVARLPLLLPRAPRSLIPPIPVSPPI    281 - 350
LAPRLSSGALKVATLPLSSRAGAPPAAVPIINMILPTVPALPGPGPGPGRAPPGGLTQPRGTENREVGIG    351 - 420
GDQGPHDKGVKRTAEVPVSEASGQAPPAKAAKQDIEDTASDAKRKRGRPRKKSGGSGERNSTPLKSAAAM    421 - 490
ESAQSSRLPWETWGSGGEGNSAGGAERPGPMGEAEKGAVLAQGQGDGTVSKGGRGPGSQHTKEAEDKIPL    491 - 560
VPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP                  561 - 616
//

Text Mined References (37)

PMID Year Title