Property Summary

NCBI Gene PubMed Count 28
Grant Count 19
R01 Count 16
Funding $1,375,780.58
PubMed Score 34.40
PubTator Score 36.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
23911394 Data show arginine methyltransferase PRMT6 methylates the AT-hook motif of regulatory factor RFX5 and downregulates HLA-DQ expression.
23079621 these data have identified as novel pathway whereby SIRT1 maintains COL1A2 synthesis in SMCs by modulating RFX5 activity.
20732328 RFXAP(C) consists of two alpha-helices that form a V-shaped structure that packs within the RFX5(N)(2) staple.
19041327 TSA treatment enhances the association of CIITA with the transcription factor RFX5, which ameliorates the down-regulation of CIITA recruitment to target promoters by HDAC2.
18842294 Observational study of gene-disease association. (HuGE Navigator)
18723135 RFXAP and RFXB have roles in relieving autoinhibition of RFX5
17611194 PPARgamma is within the RFX5.CIITA complex as judged by co-immunoprecipitation and DNA affinity precipitation studies
16464847 results demonstrate that RFX1 and RFX5 differentially interact with class I HDACs underlying the different pathways when repressing collagen synthesis
15210800 The identification of nuclear import and export sites on RFX molecules provides potential targets to modulate MHC class II expression.
12968017 RFX5 binds to the collagen transcription start site and represses collagen gene expression
More...

AA Sequence

MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLPS      1 - 70
GPTTGDKSSEPSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIR     71 - 140
EIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDLKGSESPEMGPEVTPAPRDELVEAACALTCD    141 - 210
WAERILKRSFSSIVEVARFLLQQHLISARSAHAHVLKAMGLAEEDEHAPRERSSKPKNGLENPEGGAHKK    211 - 280
PERLAQPPKDLEARTGAGPLARGERKKSVVESSAPGANNLQVNALVARLPLLLPRAPRSLIPPIPVSPPI    281 - 350
LAPRLSSGALKVATLPLSSRAGAPPAAVPIINMILPTVPALPGPGPGPGRAPPGGLTQPRGTENREVGIG    351 - 420
GDQGPHDKGVKRTAEVPVSEASGQAPPAKAAKQDIEDTASDAKRKRGRPRKKSGGSGERNSTPLKSAAAM    421 - 490
ESAQSSRLPWETWGSGGEGNSAGGAERPGPMGEAEKGAVLAQGQGDGTVSKGGRGPGSQHTKEAEDKIPL    491 - 560
VPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP                  561 - 616
//

Text Mined References (34)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23911394 2013 Differential regulation of MHCII genes by PRMT6, via an AT-hook motif of RFX5.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23079621 2012 SIRT1 deacetylates RFX5 and antagonizes repression of collagen type I (COL1A2) transcription in smooth muscle cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22649097 2012 Sequence-specific recognition of a PxLPxI/L motif by an ankyrin repeat tumbler lock.
20732328 2010 Solution structure of the heterotrimeric complex between the interaction domains of RFX5 and RFXAP from the RFX gene regulatory complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19041327 2009 HDAC2 deacetylates class II transactivator and suppresses its activity in macrophages and smooth muscle cells.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
More...