Property Summary

NCBI Gene PubMed Count 21
Grant Count 1
R01 Count 1
Funding $67,547.71
PubMed Score 10.41
PubTator Score 7.08

Knowledge Summary

Patent

No data available

Expression

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (5)

PMID Text
23822649 FOXJ1 is an important regulator of cilia gene expression during ciliated cell differentiation, with RFX3 as a transcriptional co-activator to FOXJ1.
22415835 Taken together, this study suggests ciliogenic RFX transcription factors regulate FGF-1B promoter activity and the maintenance of F1BGFP(+) NSPCs and GBM-SCs.
19671664 RFX3 controls the expression of genes involved in primary ciliary dyskinesia.
15024578 novel role for the RFX family of transcription factors as modulators of Ras signalling in epithelial cells.
12411430 Data show that two regulatory factor for X box (RFX1 and 3) binding sites in exon1 of both the mouse and human microtubule-associated protein (MAP1A) gene are important for effective transcriptional repression in non-neuronal cells.

AA Sequence

MQTSETGSDTGSTVTLQTSVASQAAVPTQVVQQVPVQQQVQQVQTVQQVQHVYPAQVQYVEGSDTVYTNG      1 - 70
AIRTTTYPYTETQMYSQNTGGNYFDTQGSSAQVTTVVSSHSMVGTGGIQMGVTGGQLISSSGGTYLIGNS     71 - 140
MENSGHSVTHTTRASPATIEMAIETLQKSDGLSTHRSSLLNSHLQWLLDNYETAEGVSLPRSTLYNHYLR    141 - 210
HCQEHKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMAMRQQPMQ    211 - 280
QKQRYKPMQKVDGVADGFTGSGQQTGTSVEQTVIAQSQHHQQFLDASRALPEFGEVEISSLPDGTTFEDI    281 - 350
KSLQSLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSPSTPTDGTTITESSNLSEIESRLPKAKLITLCK    351 - 420
HESILKWMCNCDHGMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLSNAMNNIPQRMIQTKVAAVS    421 - 490
AFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCDDNMVQRLETDFKMTL    491 - 560
QQQSTLEQWAAWLDNVMMQALKPYEGRPSFPKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLY    561 - 630
DEYMFYLVEHRVAQATGETPIAVMGEFGDLNAVSPGNLDKDEGSEVESEMDEELDDSSEPQAKREKTELS    631 - 700
QAFPVGCMQPVLETGVQPSLLNPIHSEHIVTSTQTIRQCSATGNTYTAV                         701 - 749
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24058526 2013 Genome-wide meta-analysis of systolic blood pressure in children with sickle cell disease.
23822649 2013 RFX3 modulation of FOXJ1 regulation of cilia genes in the human airway epithelium.
22415835 2012 Ciliogenic RFX transcription factors regulate FGF1 gene promoter.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20413507 2010 The transcription factor Rfx3 regulates beta-cell differentiation, function, and glucokinase expression.
20148032 2010 Rfx6 directs islet formation and insulin production in mice and humans.
19671664 2009 RFX3 governs growth and beating efficiency of motile cilia in mouse and controls the expression of genes involved in human ciliopathies.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...