Property Summary

NCBI Gene PubMed Count 19
Grant Count 12
R01 Count 5
Funding $1,726,317
PubMed Score 18.21
PubTator Score 7.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.100 0.002
posterior fossa group B ependymoma 3.100 0.000
osteosarcoma -2.268 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.200 0.001
tuberculosis -1.100 0.003
non-small cell lung cancer -1.695 0.000
lung adenocarcinoma -1.200 0.000
group 4 medulloblastoma -1.300 0.000
nasopharyngeal carcinoma -1.400 0.000
Breast cancer -1.700 0.000
ductal carcinoma in situ -1.100 0.000
invasive ductal carcinoma -1.400 0.000
ovarian cancer -1.100 0.000

Gene RIF (6)

PMID Text
24424412 Rfx2 coordinates multiple, distinct gene expression programs in multi-ciliated epithelial cells, regulating genes that control cell movement, ciliogenesis, and cilia function.
22415835 Taken together, this study suggests ciliogenic RFX transcription factors regulate FGF-1B promoter activity and the maintenance of F1BGFP(+) NSPCs and GBM-SCs.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20381594 We show binding of RFX proteins to an evolutionarily conserved X-box in the ALMS1 proximal promoter and present evidence that these proteins are responsible for ALMS1 transcription during growth arrest
19913121 Observational study of gene-disease association. (HuGE Navigator)
15024578 novel role for the RFX family of transcription factors as modulators of Ras signalling in epithelial cells.

AA Sequence

MQNSEGGADSPASVALRPSAAAPPVPASPQRVLVQAASSNPKGAQMQPISLPRVQQVPQQVQPVQHVYPA      1 - 70
QVQYVEGGDAVYTNGAIRTAYTYNPEPQMYAPSSTASYFEAPGGAQVTVAASSPPAVPSHSMVGITMDVG     71 - 140
GSPIVSSAGAYLIHGGMDSTRHSLAHTSRSSPATLEMAIENLQKSEGITSHKSGLLNSHLQWLLDNYETA    141 - 210
EGVSLPRSSLYNHYLRHCQEHKLDPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIRLKPDSPLNR    211 - 280
LQEDTQYMAMRQQPMHQKPRYRPAQKTDSLGDSGSHSGLHSTPEQTMAVQSQHHQQYIDVSHVFPEFPAP    281 - 350
DLGSFLLQDGVTLHDVKALQLVYRRHCEATVDVVMNLQFHYIEKLWLSFWNSKASSSDGPTSLPASDEDP    351 - 420
EGAVLPKDKLISLCQCDPILRWMRSCDHILYQALVEILIPDVLRPVPSTLTQAIRNFAKSLEGWLTNAMS    421 - 490
DFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCE    491 - 560
ESVVQRLEQDFKLTLQQQSSLDQWASWLDSVVTQVLKQHAGSPSFPKAARQFLLKWSFYSSMVIRDLTLR    561 - 630
SAASFGSFHLIRLLYDEYMFYLVEHRVAEATGETPIAVMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPD    631 - 700
ARSLGEPLVKRERSDPNHSLQGI                                                   701 - 723
//

Text Mined References (23)

PMID Year Title
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24424412 2014 Coordinated genomic control of ciliogenesis and cell movement by RFX2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22415835 2012 Ciliogenic RFX transcription factors regulate FGF1 gene promoter.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20381594 2010 Transcriptional regulation of the Alström syndrome gene ALMS1 by members of the RFX family and Sp1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...