Property Summary

Ligand Count 1
NCBI Gene PubMed Count 570
PubMed Score 782.63
PubTator Score 736.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 3.651 1.8
Anorexia nervosa 80 3.396 1.7
Fatty liver disease 103 3.087 1.5

Expression

  Differential Expression (35)

Disease log2 FC p
lung cancer 1.300 2.2e-03
acute myeloid leukemia -1.400 4.7e-02
adult high grade glioma -2.000 1.3e-04
Astrocytoma, Pilocytic -1.500 2.8e-05
Atopic dermatitis -2.500 3.6e-04
atypical teratoid / rhabdoid tumor -2.100 2.8e-07
autosomal dominant Emery-Dreifuss muscul... 1.248 2.2e-02
Breast cancer -2.400 2.6e-02
breast carcinoma -2.500 8.4e-25
colon cancer -1.400 8.0e-04
cutaneous lupus erythematosus -1.300 2.2e-02
cystic fibrosis -1.018 2.6e-03
ductal carcinoma in situ -2.100 2.8e-03
ependymoma -1.900 1.6e-14
gastric carcinoma -2.300 2.8e-02
Gaucher disease type 1 -1.400 4.4e-02
glioblastoma -1.600 2.5e-07
group 4 medulloblastoma 1.100 7.0e-04
intraductal papillary-mucinous adenoma (... -2.500 1.8e-03
intraductal papillary-mucinous carcinoma... -2.400 3.7e-03
intraductal papillary-mucinous neoplasm ... -2.500 1.4e-02
invasive ductal carcinoma -1.497 1.0e-02
lung adenocarcinoma -1.200 1.5e-12
medulloblastoma, large-cell -1.900 2.9e-04
non-small cell lung cancer -3.122 2.3e-23
osteosarcoma -1.798 7.3e-05
ovarian cancer -2.800 8.2e-08
pancreatic cancer 1.500 2.2e-03
pancreatic carcinoma 1.500 2.2e-03
pancreatic ductal adenocarcinoma liver m... -2.527 1.9e-02
pituitary cancer 1.300 1.1e-02
primary Sjogren syndrome 1.300 4.6e-04
primitive neuroectodermal tumor -1.500 2.1e-03
psoriasis -2.600 1.8e-05
tuberculosis 1.600 3.5e-05

 CSPA Cell Line (3)

Gene RIF (587)

AA Sequence

MICQKFCVVLLHWEFIYVITAFNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNSNGHYETAVEP      1 - 70
KFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVFQQIDANWNIQCWLKGDLKLF     71 - 140
ICYVESLFKNLFRNYNYKVHLLYVLPEVLEDSPLVPQKGSFQMVHCNCSVHECCECLVPVPTAKLNDTLL    141 - 210
MCLKITSGGVIFQSPLMSVQPINMVKPDPPLGLHMEITDDGNLKISWSSPPLVPFPLQYQVKYSENSTTV    211 - 280
IREADKIVSATSLLVDSILPGSSYEVQVRGKRLDGPGIWSDWSTPRVFTTQDVIYFPPKILTSVGSNVSF    281 - 350
HCIYKKENKIVPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHH    351 - 420
RYAELYVIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIHPISEPKDCYL    421 - 490
QSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSSVKAEITINIGLLKISWEK    491 - 560
PVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPVPDLCAVYAVQVRCKRLDGLGYWSNWSNPAY    561 - 630
TVVMDIKVPMRGPEFWRIINGDTMKKEKNVTLLWKPLMKNDSLCSVQRYVINHHTSCNGTWSEDVGNHTK    631 - 700
FTFLWTEQAHTVTVLAINSIGASVANFNLTFSWPMSKVNIVQSLSAYPLNSSCVIVSWILSPSDYKLMYF    701 - 770
IIEWKNLNEDGEIKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSDA    771 - 840
GLYVIVPVIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFIKHTASVTCGP    841 - 910
LLLEPETISEDISVDTSWKNKDEMMPTTVVSLLSTTDLEKGSVCISDQFNSVNFSEAEGTEVTYEDESQR    911 - 980
QPFVKYATLISNSKPSETGEEQGLINSSVTKCFSSKNSPLKDSFSNSSWEIEAQAFFILSDQHPNIISPH    981 - 1050
LTFSEGLDELLKLEGNFPEENNDKKSIYYLGVTSIKKRESGVLLTDKSRVSCPFPAPCLFTDIRVLQDSC   1051 - 1120
SHFVENNINLGTSSKKTFASYMPQFQTCSTQTHKIMENKMCDLTV                            1121 - 1165
//

Text Mined References (576)

PMID Year Title