Property Summary

NCBI Gene PubMed Count 538
Grant Count 694
R01 Count 398
Funding $57,447,154.63
PubMed Score 751.74
PubTator Score 736.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (76)

Disease Z-score Confidence
Obesity 616 6.648 3.3
diabetes mellitus 1,663 4.692 2.3
Hyperinsulinism 63 3.981 2.0
Hyperglycemia 120 3.967 2.0
Metabolic syndrome X 155 3.87 1.9
Cancer 2,346 3.553 1.8
Anorexia nervosa 59 3.332 1.7
Infertility 163 3.313 1.7
Hypertension 287 3.302 1.7
Fatty liver disease 84 3.113 1.6
Acquired generalized lipodystrophy 1
Acquired metabolic disease 267 2.0
Acquired partial lipodystrophy 2
Albuminuria 20
Atopic dermatitis 944
Breast cancer 3,094
Carcinoma 2,147 1.0
Cardiovascular system disease 194 2.0
Congenital generalized lipodystrophy 7
Delayed Puberty 10
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 157
Dyslipidemias 17
Female infertility 28
Fibrosis 40
Gaucher disease type 3 76
Gestational Diabetes 17
Hepatomegaly 10
Hyperlipidemia 25
Hyperphagia 4
Hypertensive disease 193
Hypogonadism 70
Immunologic Deficiency Syndromes 16
Inborn Errors of Metabolism 16
Insulin Resistance 48
Kidney Diseases 86
LEPTIN RECEPTOR DEFICIENCY 1
Mammary Neoplasms 410
Obesity, Morbid 6
Overweight 1
Pancreatic Diseases 6
Peripheral Neuropathy 303
Pituitary Diseases 1
Respiratory Tract Infections 3
acute myeloid leukemia 780
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
colon cancer 1,475
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
ependymoma 2,514
gastric carcinoma 832
glioblastoma 5,572
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pancreatic ductal adenocarcinoma liver m... 1,795 
pilocytic astrocytoma 3,086
pituitary cancer 1,972
primary Sjogren syndrome 789
primitive neuroectodermal tumor 3,031
psoriasis 6,685
tuberculosis 1,557

Expression

Synonym

Accession P48357 Q13592 Q13593 Q13594 Q92919 Q92920 Q92921 LEP-R
Symbols OBR
OB-R
CD295
LEP-R
LEPRD

Gene

PDB

3V6O  

Gene RIF (557)

PMID Text
27012037 LEPR Q223R variant is not associated with type 2 diabetes and its related metabolic traits in Iranian population.
26926121 The role of the leptin receptor transport to the plasma membrane as a part of a mechanism underlying energy imbalance and obesity.
26915772 Gene polymorphism of leptin (loci rs7799039) and leptin receptor (loci rs1137101) are correlated with Growth hormone deficiency susceptibility.
26804597 Here we propose that assessing sOb-R levels in addition to leptin concentrations in breast milk could serve as a valuable tool to investigate effects of the leptin axis in breast milk.
26589684 There is an increase in leptin receptor/leptin ratio in serum from obese rheumatoid arthritis patients compared to non-obese.
26558825 LEPR gene variants previously found to associate among Indian children did not associate with risk of obesity or obesity-related quantitative measures among Caucasian children and juvenile men from Denmark.
26478196 There are three LepR genetic polymorphisms associated with being overweight, including Lys109Arg, Gln223Arg and Lys656Asn.
26429163 Increased expression of leptin receptors in colorectal adenocarcinoma is associated with mucin-histochemical abnormalities that are manifested by sialomucins hypersecretion and reduction
26365669 Dietary fat intake modifies the effect of APOA5 and LEPR polymorphisms on serum triglycerides, cholesterol levels and obesity in young subjects.
26242176 The leptin, ObR and aromatase protein expression levels were increased in lesions in the vaginal septum and were decreased in the intestine lesions
More...

AA Sequence

MICQKFCVVLLHWEFIYVITAFNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNSNGHYETAVEP      1 - 70
KFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVFQQIDANWNIQCWLKGDLKLF     71 - 140
ICYVESLFKNLFRNYNYKVHLLYVLPEVLEDSPLVPQKGSFQMVHCNCSVHECCECLVPVPTAKLNDTLL    141 - 210
MCLKITSGGVIFQSPLMSVQPINMVKPDPPLGLHMEITDDGNLKISWSSPPLVPFPLQYQVKYSENSTTV    211 - 280
IREADKIVSATSLLVDSILPGSSYEVQVRGKRLDGPGIWSDWSTPRVFTTQDVIYFPPKILTSVGSNVSF    281 - 350
HCIYKKENKIVPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHH    351 - 420
RYAELYVIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIHPISEPKDCYL    421 - 490
QSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSSVKAEITINIGLLKISWEK    491 - 560
PVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPVPDLCAVYAVQVRCKRLDGLGYWSNWSNPAY    561 - 630
TVVMDIKVPMRGPEFWRIINGDTMKKEKNVTLLWKPLMKNDSLCSVQRYVINHHTSCNGTWSEDVGNHTK    631 - 700
FTFLWTEQAHTVTVLAINSIGASVANFNLTFSWPMSKVNIVQSLSAYPLNSSCVIVSWILSPSDYKLMYF    701 - 770
IIEWKNLNEDGEIKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSDA    771 - 840
GLYVIVPVIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFIKHTASVTCGP    841 - 910
LLLEPETISEDISVDTSWKNKDEMMPTTVVSLLSTTDLEKGSVCISDQFNSVNFSEAEGTEVTYEDESQR    911 - 980
QPFVKYATLISNSKPSETGEEQGLINSSVTKCFSSKNSPLKDSFSNSSWEIEAQAFFILSDQHPNIISPH    981 - 1050
LTFSEGLDELLKLEGNFPEENNDKKSIYYLGVTSIKKRESGVLLTDKSRVSCPFPAPCLFTDIRVLQDSC   1051 - 1120
SHFVENNINLGTSSKKTFASYMPQFQTCSTQTHKIMENKMCDLTV                            1121 - 1165
//

Text Mined References (544)

PMID Year Title
27012037 2016 Association between Leptin G2548A and Leptin Receptor Q223R Polymorphisms with Type 2 Diabetes in an Iranian Population.
26926121 2016 The BBSome Controls Energy Homeostasis by Mediating the Transport of the Leptin Receptor to the Plasma Membrane.
26915772 2016 The Relationship Between Gene Polymorphism of Leptin and Leptin Receptor and Growth Hormone Deficiency.
26804597 2016 Human breast milk and adipokines--A potential role for the soluble leptin receptor (sOb-R) in the regulation of infant energy intake and development.
26589684 2015 Serum leptin and serum leptin/serum leptin receptor ratio imbalance in obese rheumatoid arthritis patients positive for anti-cyclic citrullinated peptide antibodies.
26558825 2015 Common variants in LEPR, IL6, AMD1, and NAMPT do not associate with risk of juvenile and childhood obesity in Danes: a case-control study.
26478196 2015 Genetic Similarities between Compulsive Overeating and Addiction Phenotypes: A Case for "Food Addiction"?
26429163 2015 Interplay between expression of leptin receptors and mucin histochemical aberrations in colorectal adenocarcinoma.
26365669 2015 Interaction of dietary fat intake with APOA2, APOA5 and LEPR polymorphisms and its relationship with obesity and dyslipidemia in young subjects.
26242176 2015 Leptin, its receptor and aromatase expression in deep infiltrating endometriosis.
More...