Property Summary

NCBI Gene PubMed Count 112
PubMed Score 224.31
PubTator Score 288.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 8.89957801216577E-11
lung carcinoma 2844 1.61647741501384E-10
malignant mesothelioma 3163 4.94498049380315E-10
tuberculosis 1563 3.46078574031597E-8
pituitary cancer 1972 1.97540590021503E-6
posterior fossa group A ependymoma 1511 3.17999701583758E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.96385057066407E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.25181008384715E-5
atypical teratoid / rhabdoid tumor 4369 3.10148645497936E-4
group 3 medulloblastoma 2254 5.75597979991538E-4
interstitial cystitis 2299 7.34620642991109E-4
pediatric high grade glioma 2712 0.00124935063494218
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00197459538464593
medulloblastoma, large-cell 6234 0.00254751768136004
cystic fibrosis 1670 0.00399655412073667
lung cancer 4473 0.00422644660621732
colon cancer 1475 0.0050873665878703
primitive neuroectodermal tumor 3031 0.00686449010548546
glioblastoma 5572 0.00726463949940163
adrenocortical adenoma 134 0.0107563002465151
ulcerative colitis 2087 0.0125811797533796
pterygium 74 0.0135898853488246
dermatomyositis 967 0.0228990174421292
chronic kidney disease 90 0.0286639730797087
inflammatory breast cancer 404 0.02902883296437
nephrosclerosis 329 0.0389032630763957
pulmonary arterial hypertension 36 0.0447930564683464
Disease Target Count Z-score Confidence
Cancer 2346 3.993 2.0
Placental abruption 16 3.144 1.6

Expression

Synonym

Accession P48307 Q66ME8 Q8NAK6 Q9UC86 TFPI-2
Symbols PP5
REF1
TFPI-2

Gene

PDB

1ZR0  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (89)

PMID Text
26318044 Data show that silencing tumor-endothelial cells (EC) for trypsinogen 4 accumulated tissue factor pathway inhibitor-2 (TFPI-2) in the matrix.
26313014 Its methylation is a prognostic biomarker for hepatocellular carcinoma after hepatectomy.
25973077 DNA methylation of TFPI2 may play an important role in the carcinogenesis of cervical cancer and that the differential methylation of TFPI2 may at least partially explain the disparity in cervical cancer incidence between Uygur and Han women.
25902909 Hypermethylation of TFPI2 promoter is increased in inflamed colon tissue.
25755762 our findings suggested that the differential expression of MMP-2 and TFPI-2 have a negative correlation in pancreatic carcinoma
25755719 Our finding suggests that the decreased expression of TFPI-2 may play an important role in the carcinogenesis and progression, and may become a new adjunct marker in the diagnosis and prognosis in cholangiocarcinoma
25414083 TMPRSS4 is upregulated by silencing of TFPI-2 through aberrant DNA methylation and contributes to oncogenesis in non-small cell lung cancer.
25262870 TFPI-2 in platelets from normal or pregnant subjects and in plasma from pregnant women binds FV/Va and regulates intrinsic coagulation and fibrinolysis
25179542 TFPI-2 is a down-regulated tumor suppressor gene in oral squamous cell carcinoma, probably involving epigenetic silencing mechanisms. The loss of TFPI-2 expression is a key event for oral tumorigenesis, especially in the process of tumor metastasis.
25036127 regulation of tissue factor pathway inhibitor-2 (TFPI-2) expression by lysine-specific demethylase 1 and 2
More...

AA Sequence

MDPARPLGLSILLLFLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCE      1 - 70
GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFP     71 - 140
DEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAK    141 - 210
ALKKKKKMPKLRFASRIRKIRKKQF                                                 211 - 235
//

Text Mined References (114)

PMID Year Title
26318044 2015 Trypsinogen 4 boosts tumor endothelial cells migration through proteolysis of tissue factor pathway inhibitor-2.
26313014 2016 Methylation of tissue factor pathway inhibitor 2 as a prognostic biomarker for hepatocellular carcinoma after hepatectomy.
25973077 2015 Hypermethylation of TFPI2 correlates with cervical cancer incidence in the Uygur and Han populations of Xinjiang, China.
25902909 2015 Hypermethylation of ITGA4, TFPI2 and VIMENTIN promoters is increased in inflamed colon tissue: putative risk markers for colitis-associated cancer.
25755762 2015 Correlation and prognostic significance of MMP-2 and TFPI-2 differential expression in pancreatic carcinoma.
25755719 2015 Decreased expression of TFPI-2 correlated with increased expression of CD133 in cholangiocarcinoma.
25414083 2015 Methylation-induced downregulation of TFPI-2 causes TMPRSS4 overexpression and contributes to oncogenesis in a subset of non-small-cell lung carcinoma.
25262870 2014 Platelets contain tissue factor pathway inhibitor-2 derived from megakaryocytes and inhibits fibrinolysis.
25179542 2014 Promoter hypermethylation and silencing of tissue factor pathway inhibitor-2 in oral squamous cell carcinoma.
25036127 2014 Regulation of tissue factor pathway inhibitor-2 (TFPI-2) expression by lysine-specific demethylase 1 and 2 (LSD1 and LSD2).
More...