Property Summary

NCBI Gene PubMed Count 112
Grant Count 263
R01 Count 164
Funding $28,835,353.82
PubMed Score 224.31
PubTator Score 288.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P48307 Q66ME8 Q8NAK6 Q9UC86 TFPI-2
Symbols PP5
REF1
TFPI-2

Gene

PDB

1ZR0  

Gene RIF (89)

PMID Text
26318044 Data show that silencing tumor-endothelial cells (EC) for trypsinogen 4 accumulated tissue factor pathway inhibitor-2 (TFPI-2) in the matrix.
26313014 Its methylation is a prognostic biomarker for hepatocellular carcinoma after hepatectomy.
25973077 DNA methylation of TFPI2 may play an important role in the carcinogenesis of cervical cancer and that the differential methylation of TFPI2 may at least partially explain the disparity in cervical cancer incidence between Uygur and Han women.
25902909 Hypermethylation of TFPI2 promoter is increased in inflamed colon tissue.
25755762 our findings suggested that the differential expression of MMP-2 and TFPI-2 have a negative correlation in pancreatic carcinoma
25755719 Our finding suggests that the decreased expression of TFPI-2 may play an important role in the carcinogenesis and progression, and may become a new adjunct marker in the diagnosis and prognosis in cholangiocarcinoma
25414083 TMPRSS4 is upregulated by silencing of TFPI-2 through aberrant DNA methylation and contributes to oncogenesis in non-small cell lung cancer.
25262870 TFPI-2 in platelets from normal or pregnant subjects and in plasma from pregnant women binds FV/Va and regulates intrinsic coagulation and fibrinolysis
25179542 TFPI-2 is a down-regulated tumor suppressor gene in oral squamous cell carcinoma, probably involving epigenetic silencing mechanisms. The loss of TFPI-2 expression is a key event for oral tumorigenesis, especially in the process of tumor metastasis.
25036127 regulation of tissue factor pathway inhibitor-2 (TFPI-2) expression by lysine-specific demethylase 1 and 2
More...

AA Sequence

MDPARPLGLSILLLFLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCE      1 - 70
GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFP     71 - 140
DEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAK    141 - 210
ALKKKKKMPKLRFASRIRKIRKKQF                                                 211 - 235
//

Text Mined References (114)

PMID Year Title
26318044 2015 Trypsinogen 4 boosts tumor endothelial cells migration through proteolysis of tissue factor pathway inhibitor-2.
26313014 2016 Methylation of tissue factor pathway inhibitor 2 as a prognostic biomarker for hepatocellular carcinoma after hepatectomy.
25973077 2015 Hypermethylation of TFPI2 correlates with cervical cancer incidence in the Uygur and Han populations of Xinjiang, China.
25902909 2015 Hypermethylation of ITGA4, TFPI2 and VIMENTIN promoters is increased in inflamed colon tissue: putative risk markers for colitis-associated cancer.
25755762 2015 Correlation and prognostic significance of MMP-2 and TFPI-2 differential expression in pancreatic carcinoma.
25755719 2015 Decreased expression of TFPI-2 correlated with increased expression of CD133 in cholangiocarcinoma.
25414083 2015 Methylation-induced downregulation of TFPI-2 causes TMPRSS4 overexpression and contributes to oncogenesis in a subset of non-small-cell lung carcinoma.
25262870 2014 Platelets contain tissue factor pathway inhibitor-2 derived from megakaryocytes and inhibits fibrinolysis.
25179542 2014 Promoter hypermethylation and silencing of tissue factor pathway inhibitor-2 in oral squamous cell carcinoma.
25036127 2014 Regulation of tissue factor pathway inhibitor-2 (TFPI-2) expression by lysine-specific demethylase 1 and 2 (LSD1 and LSD2).
More...