Property Summary

NCBI Gene PubMed Count 120
PubMed Score 231.54
PubTator Score 288.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 4.053 2.0
Placental abruption 18 3.128 1.6

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical adenoma -2.800 1.1e-02
atypical teratoid / rhabdoid tumor 1.500 2.9e-02
Breast cancer -1.100 2.3e-02
chronic kidney disease 2.500 2.9e-02
colon cancer -1.500 5.1e-03
cystic fibrosis 1.060 2.6e-03
dermatomyositis 1.200 2.3e-02
ependymoma 1.900 5.7e-03
glioblastoma 1.300 1.6e-02
group 3 medulloblastoma 1.100 3.6e-04
interstitial cystitis 3.900 5.0e-03
intraductal papillary-mucinous adenoma (... -2.800 2.4e-03
intraductal papillary-mucinous carcinoma... -2.600 5.5e-03
intraductal papillary-mucinous neoplasm ... -2.700 2.7e-02
lung cancer -1.200 4.2e-03
lung carcinoma -1.100 1.6e-10
malignant mesothelioma -7.000 3.5e-09
medulloblastoma, large-cell 1.400 4.7e-02
nephrosclerosis 1.083 3.9e-02
ovarian cancer -4.700 3.3e-09
pediatric high grade glioma 2.100 1.2e-03
pituitary cancer -3.100 2.0e-06
primitive neuroectodermal tumor 1.100 6.9e-03
pterygium -1.200 1.4e-02
pulmonary arterial hypertension -2.900 4.5e-02
tuberculosis -1.400 3.0e-04
ulcerative colitis 2.600 1.3e-02

Gene RIF (97)

AA Sequence

MDPARPLGLSILLLFLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCE      1 - 70
GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFP     71 - 140
DEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAK    141 - 210
ALKKKKKMPKLRFASRIRKIRKKQF                                                 211 - 235
//

Text Mined References (122)

PMID Year Title