Property Summary

NCBI Gene PubMed Count 36
PubMed Score 32.11
PubTator Score 31.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25767811 the expression of REG Ialpha and REG Ibeta may be upregulated in human beta cells under inflammatory conditions through the JAK/STAT pathway
24007603 Additional serum biomarkers, particularly SYCN and REG1B, when combined with CA19.9, show promise as improved diagnostic indicators of pancreatic cancer, which therefore warrants further validation.
23553156 Higher REG1B stool concentrations at month 3 were significantly and independently associated with a growth shortfall in Bangladeshi and Peruvian children.
23519454 Immunohistochemistry against known cell-type markers on serial sections has localised the expression of REGs to metaplastic Paneth cells (REG1A, REG1B and REG3A) and enteroendocrine cells (REG4), with a marked expansion of expression during inflammation.
22018336 The expression of MK-1 and/or RegIV might be closely related to the carcinogenesis, clinical biological behaviors, and prognosis of gallbladder adenocarcinoma
21586335 REG 1A and REG 1B were upregulated during amebiasis and may function to protect the intestinal epithelium from parasite-induced apoptosis.
20056108 This finding suggests that REG I may act through IL-6 to exert effects on squamous esophageal cancer cell biology.
11796176 Observational study of gene-disease association. (HuGE Navigator)
11796176 did not find any association between abnormalities of either reg1 alpha or reg1 beta gene with type 1 diabetes mellitus, fibrocalculous pancreatopathy, or type 2 diabetes mellitus

AA Sequence

MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSG      1 - 70
NLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASL     71 - 140
TSCSGFKKWKDESCEKKFSFVCKFKN                                                141 - 166
//

Text Mined References (36)

PMID Year Title
25767811 2015 Synergistic activations of REG I ? and REG I ? promoters by IL-6 and Glucocorticoids through JAK/STAT pathway in human pancreatic ? cells.
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
24007603 2013 Validation of four candidate pancreatic cancer serological biomarkers that improve the performance of CA19.9.
23553156 2013 REG1B as a predictor of childhood stunting in Bangladesh and Peru.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23519454 2013 REG gene expression in inflamed and healthy colon mucosa explored by in situ hybridisation.
22018336 2011 Expression of MK-1 and RegIV and its clinicopathological significances in the benign and malignant lesions of gallbladder.
21586335 2011 The expression of REG 1A and REG 1B is increased during acute amebic colitis.
20056108 2010 Regenerating gene I regulates interleukin-6 production in squamous esophageal cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...