Property Summary

NCBI Gene PubMed Count 37
PubMed Score 32.44
PubTator Score 31.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

AA Sequence

MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSG      1 - 70
NLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASL     71 - 140
TSCSGFKKWKDESCEKKFSFVCKFKN                                                141 - 166
//

Text Mined References (37)

PMID Year Title