Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.49
PubTator Score 9.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver diseases 87 0.0 0.0

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -2.500 3.7e-02
lung adenocarcinoma 1.400 4.6e-03
lung carcinoma 1.900 9.0e-06
malignant mesothelioma -3.500 1.4e-08

Synonym

Accession P48230 B2RDA4
Symbols ILTMP
il-TMP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLK      1 - 70
NNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDE     71 - 140
ALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV            141 - 202
//

Text Mined References (16)

PMID Year Title