1. Home
  2. Targets
  3. Transmembrane 4 L6 family member 4

Tbio Transmembrane 4 L6 family member 4

Regulates the adhesive and proliferative status of intestinal epithelial cells. Can mediate density-dependent cell proliferation.

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation.[provided by RefSeq, Mar 2011]

 Comments

Property Summary

NCBI Gene PubMed Count 14
Grant Count 6
R01 Count 4
Funding $364,696.22
PubMed Score 8.36
PubTator Score 9.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (5)

Disease Z-score Confidence
Liver diseases 66
intraductal papillary-mucinous adenoma (... 2,956 
lung adenocarcinoma 2,713
lung carcinoma 2,844
malignant mesothelioma 3,162

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -3.500 0.000
intraductal papillary-mucinous adenoma (... -2.500 0.037
lung adenocarcinoma 1.400 0.005
lung carcinoma 1.900 0.000

Synonym

Accession P48230 B2RDA4
Symbols ILTMP
il-TMP

Gene

TM4SF4

 Grant Application (6)

 GO Component (1)

 GO Process (1)

 Compartment GO Term (9)

 IMPC Term (1)

 MGI Term (2)

 UniProt Keyword (6)

Gene RIF (5)

PMID Text
25344917 TM4SF4 expression was correlated with the increased expression of IGF1, consequently resulting in IGF1R activation in lung adenocarcinoma.
24282057 TM4SF4 interacts with hTHTR-2 and influences the physiological function of the thiamine transporter in human intestinal epithelial cells.
23296076 TM4SF4 is a membrane protein that may have a role in attenuating liver cancer cell growth
22011044 Results suggest that S100B, TM4SF3, and OLFM4 overexpression may affect metastatic behavior of tumor cells in Taiwanese colorectal cancer patients.
18765015 expression of transmembrane 4 superfamily member 4 (TM4SF4) and matrix metalloproteinase 26 (MMP26) was found to be significantly decreased during the implantation window in patients with polycystic ovary syndrome.

AA Sequence 

MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLK      1 - 70
NNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDE     71 - 140
ALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV            141 - 202
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25344917 2014 TM4SF4 overexpression in radiation-resistant lung carcinoma cells activates IGF1R via elevation of IGF1.
24282057 2014 Association of TM4SF4 with the human thiamine transporter-2 in intestinal epithelial cells.
23296076 2013 Adenovirus-mediated delivery of siRNA targeting TM4SF4 attenuated liver cancer cell growth in vitro and in vivo.
22011044 2012 Overexpression of S100B, TM4SF4, and OLFM4 genes is correlated with liver metastasis in Taiwanese colorectal cancer patients.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18765015 2008 Microarray evaluation of endometrial receptivity in Chinese women with polycystic ovary syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...